(data stored in ACNUC30630 zone)

EMBL: AE017283.PE330

AE017283.PE330       Location/Qualifiers
FT   CDS_pept        complement(390596..391600)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0340"
FT                   /product="putative phosphate transport system permease
FT                   protein PstC"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0340"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82095"
FT                   /db_xref="GOA:Q6AAX1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011864"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAX1"
FT                   /protein_id="AAT82095.1"
FT                   /translation="MAETTSPAQRKLTAASRMKPVSRVGDTIFAGASSVIAIALAIIVI
FT                   LMFVFLMKTAAPTLLANTDNFFTSRAWTTDQNPPAFGIQALLWTTVISSLLALLIAVPL
FT                   SVGIALFITQLAPRKLASPVAFVVDLLAAVPSIVFGLWGGIVFGSSGIINGLRGAIIKA
FT                   LGWIPIFSEDPSWSSATGTVYLASLVLAIMILPIITAVSRDVMAQTPHDQVEAALALGS
FT                   TRWEVIKLAVLPHSRSGIISGSMLGLGRALGETLAVTLILQTMSPMALKQNLNLSIFVG
FT                   GETFASKIAGNFSEAISDPTSLGALVASALALFVITFVVNATARLIAAKGVKR"
     atggctgaaa ccacatcgcc ggcacagcgg aaactcacgg cggcatcccg catgaagccg        60
     gtgtcgcggg tcggggacac gattttcgct ggcgcctcgt cggttattgc catagccctg       120
     gccatcatcg tcatcctgat gttcgtcttc ctcatgaaga cggcagcccc aacattgttg       180
     gctaacaccg ataacttttt cacgtcccgg gcttggacaa cggatcagaa cccgccggcc       240
     tttggtatcc aggccctgct atggacgaca gtcatctcat ccctgcttgc cctgctcatc       300
     gcagtgccac tctcggtggg catcgctctg tttatcaccc aactcgcacc caggaagctc       360
     gctagcccgg tcgcgttcgt cgtcgatttg ctggcggcag tcccctcgat cgtcttcggt       420
     ctgtggggcg gcatcgtctt cggatcgtcg ggaatcatca acggtttacg cggggccata       480
     atcaaagcgc tcggctggat tccgatcttt tccgaggatc cgtcgtggtc ctcggctact       540
     ggcacggtct accttgccag tctcgtcctg gccatcatga tcctgccaat tatcactgct       600
     gttagccgcg acgtcatggc ccagacgccc catgatcaag tcgaggccgc gctcgccctc       660
     ggatcgacgc gctgggaggt catcaagctt gcagtgctcc cccactcgcg gtccggcatc       720
     atttccggat ccatgttggg tctaggacgc gccctcggcg agaccctggc tgtcaccctc       780
     atcctgcaga cgatgagccc catggcgctc aaacagaacc tcaacctgtc gatcttcgtc       840
     ggtggtgaga cattcgcgtc gaagattgcc ggtaacttct ccgaggccat tagcgatccc       900
     acctcgctgg gtgccctcgt ggcgtcggcc ctggccctgt tcgtcattac cttcgtggtc       960
     aacgcgactg cccggttgat tgcggcgaag ggggttaagc gatga                      1005
//

If you have problems or comments...

PBIL Back to PBIL home page