(data stored in ACNUC30630 zone)

EMBL: AE017283.PE333

AE017283.PE333       Location/Qualifiers
FT   CDS_pept        complement(393982..396087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0343"
FT                   /product="polyphosphate kinase"
FT                   /EC_number="2.7.4.1"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0343"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82098"
FT                   /db_xref="GOA:Q6AAW8"
FT                   /db_xref="InterPro:IPR003414"
FT                   /db_xref="InterPro:IPR024953"
FT                   /db_xref="InterPro:IPR025198"
FT                   /db_xref="InterPro:IPR025200"
FT                   /db_xref="InterPro:IPR036830"
FT                   /db_xref="InterPro:IPR036832"
FT                   /db_xref="InterPro:IPR041108"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAW8"
FT                   /protein_id="AAT82098.1"
FT                   /translation="MAKKPTPGTSPSSPDELPEGRYSDRELSWLAFNERVLDLARDTER
FT                   IPLLERAKFLAIFSSNLDEFFMVRVAGLKRRIDAGVAVPSVAGMLPRELHDAILARTHD
FT                   LVSEQSRVFAEEVRPGLVDEGIEILRWAELSDDEKGRMRTLFSERIFPILTPLAVDPSH
FT                   PFPYIRGLSINLAVMLANPITGAEQFARVKVPSVLPRLVNLGEGRFLPLEEIISRHLDQ
FT                   LFTGMHVLQHTTFRVTRNEDLEVEEDDAENLLFALEKELLRRKVGRPPVRLEVQDDISA
FT                   EMLELLTRELDIRDKEVFRLPAPLDLTGLFSLADVDRDDLSYPNFLPITHPHLAEVETA
FT                   RPADMFAAIRRRDVLVHHPYDSFATSVQRFIEQAAQDPQVLAIKQTLYRTSGDSPIIDA
FT                   LVDAAEAGKQVLAVVEIKARFDEQANITWARLLERAGVHVVYGMVGLKTHCKLAMVIRD
FT                   EGEGLRRYAHIGTGNYNPKTARQYEDLGLLTSNPIITEDVARLFNHLSGMTAEKRYRRL
FT                   LVAPESIRSGIIDAIEREIDNKKAGLPAGVRIKVNSIVDERVIDALYRASRAGVPVDLW
FT                   VRGICSIRPGVPGLSENIRVISILGRFLEHSRIFWFANGGRPMVAIGSADLMHRNLDRR
FT                   VEALVGLSNKQHVAEVEEMFDMAFDPGTVSWHLQDRTWTEVSRGPDDIPLTDLQEELIR
FT                   RTRDRRR"
     atggccaaga agcccacccc cgggacttcc ccgtcttctc ccgacgagct gccggagggt        60
     cgctacagcg atcgtgagct atcgtggctc gccttcaacg aacgggtgct ggatcttgcg       120
     cgcgataccg aacgcatccc tctgctcgag agagcgaagt ttctggccat tttctcgtcc       180
     aacctcgacg aatttttcat ggtgcgagtc gccggtctca aacgccgtat cgacgctgga       240
     gtcgccgtgc cttccgtcgc tgggatgcta ccccgtgagc tccacgatgc cattctggcc       300
     cgcacccatg acctagtttc tgaacaatct cgggtattcg ctgaggaggt gcgccccggg       360
     ctggtagatg aaggcattga gatcctgcgt tgggccgagc tgtccgatga tgaaaagggc       420
     cgcatgcgca ccttgttctc ggaacggatt ttccccattc ttaccccctt agccgtcgac       480
     ccatcccacc ccttcccgta cattcgcggc ctatcgatca acctggccgt catgctggca       540
     aatcccatta ctggcgcaga gcagttcgct cgggtcaaag tgccgtcggt gctgcctcgg       600
     ctggtcaacc tgggcgaggg acgattcctt ccgctagagg aaatcatcag tcgtcacctc       660
     gaccaactgt tcaccggcat gcacgtgctg caacacacca ccttccgcgt cactcgaaac       720
     gaagacctcg aggtcgagga ggatgacgcc gagaacctgc tgttcgctct cgagaaggag       780
     ctgctgcgcc gcaaggtggg ccgccctccg gtgcgattgg aggtccagga cgacatttcc       840
     gcggagatgc tcgagctact cacccgtgaa cttgacatca gagacaagga ggtcttccgg       900
     ctgccggccc cactggacct gaccggcctg ttctcgctgg ccgacgtcga ccgcgacgat       960
     ctgtcctacc cgaacttcct gcccatcacg catccgcact tggccgaggt ggagacggct      1020
     cgcccagccg acatgtttgc cgcgatccgt cgtcgcgacg tgctcgtcca tcacccctac      1080
     gactccttcg ccaccagcgt gcagcggttc atcgagcaag ctgctcaaga cccccaggtg      1140
     ctggccatca aacaaaccct gtaccgcact tccggcgact cccccatcat tgacgccctc      1200
     gtcgatgccg ccgaggctgg caagcaggtg ctggcggtcg tggagattaa ggcgaggttc      1260
     gacgaacagg ccaacatcac ctgggcccga ctgctggaac gggccggagt ccacgtcgtt      1320
     tacggcatgg tgggcctcaa gacccactgc aagttggcca tggtaatccg cgacgagggc      1380
     gaagggttgc gccgctacgc ccacatcggc accggaaact acaatcccaa gacggctcgc      1440
     cagtacgagg acctcggtct actaacctcc aacccgatca ttaccgaaga cgtcgcgagg      1500
     ctgtttaatc acctatccgg gatgacggct gagaaacgtt accgccgtct cctggtagcc      1560
     cctgaaagca tccggagcgg catcatcgac gcgattgagc gcgagatcga caataagaag      1620
     gctgggttgc ctgccggagt gaggatcaag gtcaactcca tcgtcgatga gcgcgtcatc      1680
     gacgcccttt accgcgcctc ccgcgccggt gttccagtag acctgtgggt acgtggtatt      1740
     tgctctatca gaccgggggt tcccgggctc agtgagaaca tccgggtcat ctctatcctg      1800
     ggccggttcc tagaacactc ccgcatcttc tggttcgcca acggtggtcg cccgatggtg      1860
     gcaatcggct cagccgatct catgcaccgc aacctggacc gccgggtaga agcccttgtc      1920
     ggcttgtcca acaagcagca cgtggcggag gttgaagaga tgttcgacat ggccttcgac      1980
     ccaggtacgg tgtcgtggca cctgcaggat cgcacttgga ccgaggtgtc acgcggaccg      2040
     gacgacatcc ccctaactga cttacaagaa gaactcatcc gacgcacccg cgacaggagg      2100
     cggtga                                                                 2106
//

If you have problems or comments...

PBIL Back to PBIL home page