(data stored in ACNUC30630 zone)

EMBL: AE017283.PE334

AE017283.PE334       Location/Qualifiers
FT   CDS_pept        complement(396209..396922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0344"
FT                   /product="transcriptional regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0344"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82099"
FT                   /db_xref="GOA:Q6AAW7"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAW7"
FT                   /protein_id="AAT82099.1"
FT                   /translation="MMGCDIVDDMISNNAISAWEGIRMARLSLLGPLDAPLPQALELLP
FT                   HSISRYDDLKECMSHLEGVDVVLVDCHDEPAKAREACLRLSCHERRVPVLLLVGSDTLS
FT                   VISPDWGMDDFLCDSATPSEAETRLRCLFTIQVTNQLVAGPFTVDEDGYTASVGDKDLD
FT                   LTYTEFELLKYLVGHPGRVLTRDLLLSDVWGYDYYGGTRTVDVHIRRLRAKVGPEYEGH
FT                   IQTVRSVGYRFQAER"
     atgatgggat gcgacatcgt tgacgacatg atctcgaaca acgcgatttc agcatgggag        60
     ggcatccgga tggcacgact gtccttgctg ggtccgttag atgccccgct acctcaggcc       120
     ttggaactgt taccgcacag catctctcgc tacgacgacc tgaaggaatg catgtctcat       180
     ctggaagggg tcgacgtcgt gctcgtcgac tgccacgacg aaccggccaa ggcgcgcgag       240
     gcttgtctgc ggctgtcctg tcacgagaga cgagtgccgg tcctgctgtt ggtcggctcc       300
     gacactctct cggtcatcag ccccgactgg ggaatggacg actttctgtg cgattcggca       360
     accccatcgg aagccgagac ccggcttcgc tgtctgttta cgatccaggt caccaaccag       420
     ctcgtggccg gaccgttcac cgtcgacgag gacgggtaca cagcaagtgt cggggacaag       480
     gaccttgatc tcacctacac cgagttcgag ctgctgaagt acctcgtcgg acaccccggt       540
     agagtactta cccgagacct cctgttgtca gacgtgtggg gttacgacta ctacggtggt       600
     acccggaccg tagacgtcca tatccgtcgt ctgcgcgcca aagtcggccc agagtacgaa       660
     ggccacatcc aaacggtgcg gtcggtgggc taccgattcc aggcggaacg ttaa             714
//

If you have problems or comments...

PBIL Back to PBIL home page