(data stored in ACNUC30630 zone)

EMBL: AE017283.PE350

AE017283.PE350       Location/Qualifiers
FT   CDS_pept        complement(408450..409631)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0360"
FT                   /product="putative sensor kinase"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0360"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82115"
FT                   /db_xref="GOA:Q6AAV1"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAV1"
FT                   /protein_id="AAT82115.1"
FT                   /translation="MRTVGMILSAIIGAVVGAGLMVLMSRVVESSRHPVDTLATDIEAI
FT                   EVNSALARALDLTTEAAVIVGPHDEVLHTTLGARSMELVRGSRIANETLLKLVRTARRE
FT                   GRDIVDTMEMKRASTGADLILTVRAGPLDDHGNAIIAASDSSRHVRLAETRRDFVANVS
FT                   HELKTPIGAVSILAEAIEGAADDPEAIRHFSQRLTAESSRLSALVTQIIDLSRLQADEP
FT                   LLRAEPVAVADVIDEAVSRHREQAANREVSLVVRCDDDLWVLGDQSQLTEAVANLVHNA
FT                   IVYSEPKVRVAVSARRVRDVDTDVIAIAVADNGIGISEADQKRIFERFYRVDYSRSREN
FT                   GGTGLGLSLVKHTCQAHGGSVDVWSKLGQGSTFTLRLPTLDVDHHNESDQEES"
     atgcgaactg tgggcatgat tctgtcagcg atcattggtg ccgtcgtcgg cgctggattg        60
     atggtcctca tgagccgcgt ggtggagtcg tctcgtcatc ccgtagacac cctcgccacc       120
     gacatcgagg ctatcgaggt aaattcggcc ctcgcccgag ctctcgactt aaccaccgag       180
     gcagccgtca tcgtcggacc gcatgacgag gttctccaca ccacattggg tgcgcgatcg       240
     atggaactcg tacgcggttc acgtatcgct aatgagactc tgctcaaact ggtgcgcact       300
     gcccggcgcg aggggcgcga catcgtcgac accatggaga tgaaacgggc atccacgggg       360
     gccgacctca ttctcaccgt gcgagccggc cctctcgatg atcacggcaa cgccattatc       420
     gctgccagtg atagctcgcg acatgtcagg ctggccgaga cccgccgaga cttcgttgcc       480
     aatgtctctc acgagttgaa aacccccatc ggtgctgtct ctatcctcgc cgaggccatc       540
     gaaggtgcag ctgatgaccc ggaggccatc cgacatttct cccagcggct gacagcagag       600
     tcctcgcgac tgtctgccct cgtcacccag atcatcgact tatcccggct acaagccgac       660
     gaaccactac tgcgcgccga accagtggcc gtcgcagacg tcattgacga ggccgtctca       720
     cgccaccgcg aacaagctgc caatcgagag gtgtccttag tagtgcgctg cgacgacgac       780
     ctgtgggtcc tcggggatca aagccagctc accgaagcag tcgccaatct tgttcacaac       840
     gccatcgtct attccgagcc aaaggtccgg gtagcggtct ccgcccggcg agtccgtgac       900
     gtcgacaccg acgtcatcgc gatcgccgtc gccgacaacg gaatcggtat tagcgaggcc       960
     gaccaaaagc gtattttcga acggttctac cgggtggact actcccgttc cagggaaaac      1020
     ggtggaaccg gtctgggatt gtcgctggtt aagcacacct gccaggcgca cgggggatct      1080
     gtcgatgtgt ggagcaagtt gggccagggg tccacgttca cccttcgact tccaaccctc      1140
     gacgttgatc accacaacga atccgatcag gaggagtcat ga                         1182
//

If you have problems or comments...

PBIL Back to PBIL home page