(data stored in ACNUC30630 zone)

EMBL: AE017283.PE36

AE017283.PE36        Location/Qualifiers
FT   CDS_pept        38497..39975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0041"
FT                   /product="secretion system protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0041"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81801"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABJ7"
FT                   /protein_id="AAT81801.1"
FT                   /translation="MTIDHAVSRYAQDAPVVPLDDGKDLAGVLSRISPSPHVSPAAVSP
FT                   RPNPRRFEAKDIDWRTVVSLRRKASERISSERASHRERTGVDLSGDDVRMLGRSIVRQA
FT                   VESHAEKLTAEGQALWSAQTKDAYVRAVMDAIFGYGRLQPLFEIQDAENIEINGCDRVF
FT                   VQYGDGRREPGPVVADDDAELVEAIRFLGESANPPRPFDDAHPTMTVALGSQYRLHAIG
FT                   FGLSYRPSVVIRHHTLTRVTIDDLVNTAMMPHHVGVLLRAAVLARRSIVIAGDQGAGKT
FT                   TLLRALVDAIPPTERFGTLETDYELLTHLNPDRDNMVAFQATVGLGEKVDGHCVGEFTV
FT                   ADLIPEALRQNLSRLVVGEVRGVEAAAMFEAMQAGAGTMSTTHSHSATSTMDRLAGRVA
FT                   MGGVMTIEEAYRQIAHNITFLVHVTLVDDTWRGGTRTRHITEIRQLTGALENGRPVTHL
FT                   TYAAPTPTSPGVFHPDPALVAELSHYEPEVTRWV"
     atgacgatcg accatgcagt aagccgatat gcacaggacg ctccggtagt cccgctcgat        60
     gatgggaagg accttgccgg tgtgctttcc cgcatctccc catcgccaca cgtatcgccg       120
     gcagctgtgt ctcctcgtcc caacccacga cgattcgagg cgaaggacat tgattggcgt       180
     accgtcgttt cattgcgtcg gaaggcatct gaacgtatct cgtcggaacg ggcgtcccat       240
     cgggaacgta ccggcgtcga cctgagcggc gatgatgtgc gaatgcttgg ccggtcgatc       300
     gtgcggcagg ctgtcgagtc ccacgcggag aaattgacgg ctgaggggca agccctgtgg       360
     agcgcgcaga ctaaagacgc gtacgtccgc gcggtcatgg atgccatctt tgggtacggg       420
     cggctacagc ctcttttcga aatccaagac gcggagaata ttgaaatcaa tggctgcgac       480
     cgggtctttg tgcagtacgg ggatggacga cgcgaacctg gtcccgtagt ggccgacgat       540
     gacgctgagc tcgtcgaggc gattcggttc ctcggggagt cggctaaccc gcctcggcct       600
     tttgacgacg ctcaccccac tatgacagtg gcgttgggat cccaatatcg actgcacgct       660
     atcgggtttg ggctgtccta ccggccctcg gtcgtcattc gccaccacac cctgacgagg       720
     gtgacgatcg acgacctcgt caataccgcg atgatgcccc accacgtcgg ggtgttgcta       780
     cgtgcggccg tcctggcgcg tcggtccatc gtcatcgccg gagaccaggg tgcgggcaag       840
     acgacgctgc tacgggcttt ggttgacgct atcccaccta ccgagcggtt cggaaccctt       900
     gaaactgact atgaactgct cactcacctc aatccagatc gcgacaatat ggtcgccttc       960
     caggccaccg tggggctagg agagaaagtg gacgggcatt gcgtgggcga gttcaccgtc      1020
     gccgacctga ttccggaggc actgcgtcaa aacctctcgc gtttggtggt gggcgaggtt      1080
     cgtggcgttg aggcagctgc catgttcgag gcgatgcagg ccggtgccgg aacgatgagc      1140
     accactcact cccactcggc cacctcgacc atggatcggt tggctggacg agttgccatg      1200
     ggaggggtca tgacgattga ggaggcctat cggcagatcg cgcacaacat cacgttcctc      1260
     gtgcacgtca ctctcgtcga tgacacctgg cgaggaggca cccgaactcg tcacatcacc      1320
     gagatccgcc aactcaccgg ggcgttagag aatgggcgac cggtcaccca cctcacctat      1380
     gctgcgccaa cgccaactag tccaggcgtg ttccacccgg atcccgctct cgttgctgag      1440
     ttgtcccact acgagccgga ggtgacgaga tgggtatga                             1479
//

If you have problems or comments...

PBIL Back to PBIL home page