(data stored in ACNUC30630 zone)

EMBL: AE017283.PE368

AE017283.PE368       Location/Qualifiers
FT   CDS_pept        428537..429409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0381"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0381"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82133"
FT                   /db_xref="InterPro:IPR016624"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAT3"
FT                   /protein_id="AAT82133.1"
FT                   /translation="MTQRSPLTHWGREDWCNLADRLVTTAMSHATPGHGRIVMPGEPGG
FT                   LGPDIDGLEELASWWAGGVAAGVDQRAEDRWLRPSEHWQAVVEACSLALTLHFTKPWIW
FT                   DQLSQRTQEQAVEWFQDVRNPEIPDNNWIWFQVIVETFLRGLGADWDEALVREHLERHE
FT                   DWYRTDGWISDGPRRCYDHYVGWAMETLPALWTLMDPTWDLSRDFATVHGPRLRRYLED
FT                   VPFLVGADLDGHGGTAPLIQGRSLIYRWCTCAPLWAGTFMGVSPVSPRTDEAYLLGNRK
FT                   AFPRSRSGR"
     atgacgcaga ggagtccact gacccattgg ggacgcgagg actggtgcaa tctcgctgat        60
     cgtctggtga cgacggccat gagccatgca acaccaggcc acgggcggat tgtgatgccg       120
     ggggaaccgg gcggactggg ccctgacatc gacgggctcg aagagttggc gtcgtggtgg       180
     gccggaggcg tcgccgccgg cgtcgaccag agggccgagg atcgctggct gcgaccatct       240
     gaacattggc aggccgttgt cgaggcctgt tcattggccc tgacgctcca cttcaccaag       300
     ccctggatct gggatcagct ctctcagcgg acccaggagc aggccgtcga gtggtttcag       360
     gacgtgcgca atcccgagat ccccgacaac aactggatct ggttccaggt catcgtcgag       420
     accttcctgc gaggcctcgg tgccgactgg gacgaggccc tcgtccgcga gcacctcgaa       480
     cgtcacgagg actggtaccg caccgacggt tggatcagcg acggaccgag gcgctgctac       540
     gaccactatg tcggatgggc catggagact ctgccggccc tgtggaccct catggacccg       600
     acctgggatc ttagcagaga cttcgccacc gttcacgggc ccaggttgag gagatacctt       660
     gaggacgtcc ccttcctcgt cggagctgat ctggacggcc acggaggtac cgctcctctc       720
     atccagggac gtagcctcat ctaccggtgg tgcacctgcg cgccgctgtg ggccggaacc       780
     ttcatgggtg tttctccagt gtccccccgg actgacgagg cgtatctgct cgggaaccgt       840
     aaggcatttc ctcgatcgag gagcgggcgc tga                                    873
//

If you have problems or comments...

PBIL Back to PBIL home page