(data stored in ACNUC30630 zone)

EMBL: AE017283.PE374

AE017283.PE374       Location/Qualifiers
FT   CDS_pept        434660..435178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0387"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0387"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82139"
FT                   /db_xref="InterPro:IPR005531"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAS7"
FT                   /protein_id="AAT82139.1"
FT                   /translation="MTDNKTASAKSDATKTENLPETTTKETLPPSPLHTDHGSTLIAEQ
FT                   VVQKIAGIACREVPGVHAMGSTGRRMLSSITDRIPGSTTNVSNGVQVEKGERQCAIDLS
FT                   VVIEYGYSVVEVANKLRETIIDAVEYGTGLEVVEVNVQVTDVYIQGEDDHDDDQSDQVA
FT                   GQRKNTELS"
     atgactgaca acaagaccgc ttccgctaaa tccgatgcca cgaaaaccga gaacctgcca        60
     gagacaacga ccaaagagac cctgcctccc tcgccgctgc acaccgatca cggctccacc       120
     ctcatcgctg agcaggtagt ccagaagatt gccggtattg cctgccgtga agtccccggt       180
     gtgcacgcca tgggatccac tggtcgccgg atgctcagct ctatcaccga tcgcatcccc       240
     ggatcgacta ccaacgtgtc gaacggcgtc caggttgaaa agggcgagcg tcagtgcgct       300
     atcgatctgt ccgtggttat tgagtacggc tactcagttg ttgaggtcgc caataagctc       360
     cgcgaaacca ttattgacgc cgttgagtac ggcaccggcc ttgaggtcgt tgaagtgaat       420
     gtccaggtca ccgatgtcta cattcagggt gaggacgatc acgacgacga ccagtctgat       480
     caggttgccg gccagcgcaa gaacaccgaa ctttcctga                              519
//

If you have problems or comments...

PBIL Back to PBIL home page