(data stored in ACNUC30630 zone)

EMBL: AE017283.PE378

AE017283.PE378       Location/Qualifiers
FT   CDS_pept        436341..437057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0391"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0391"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82143"
FT                   /db_xref="GOA:Q6AAS3"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAS3"
FT                   /protein_id="AAT82143.1"
FT                   /translation="MKGRANRTRLAVVGIIGLVVVAWFMLVRFNVVSSWGWRQPKPDAP
FT                   IVDVPKAWRTDYASWALLIVGILVAVIGLVWLLRQFSSSNRAHTYGMSHEADHGSTVLS
FT                   TDALGRAVEEQIEEFPGVSSASVRFFGARVAPEMMVQIDIDDRADVRKLVDRLESEVAR
FT                   DVEATLDAKLVRFGTKLRTGPHVTGMGVSHVGVTEVPNIDDSGDSLPANPMPKSTFLQE
FT                   KSDRAKPRTREGKVLA"
     atgaagggcc gcgcaaatag aacacgactc gccgtcgtcg ggatcatcgg tctggtagtg        60
     gttgcgtggt tcatgctggt gcggttcaac gtcgtctcgt cgtggggatg gcggcagccc       120
     aaacccgacg cccctatcgt cgacgtgccg aaggcatggc gaactgacta cgcatcatgg       180
     gctctgctca ttgtcgggat cttagtcgcg gtgattgggt tggtctggct gcttcgtcag       240
     ttctcgtcga gcaatcgggc ccacacctac ggcatgagcc acgaggcgga ccacggctca       300
     acagtgctgt ccacagacgc tctgggaagg gccgttgagg agcagatcga ggagttcccc       360
     ggagtcagta gcgctagcgt gagattcttt ggagcccgtg tggctcccga gatgatggtt       420
     cagatcgaca tcgatgaccg cgccgacgtg cgaaagctcg tcgaccggtt ggagtccgaa       480
     gtggctcgcg acgtcgaggc gaccctggac gcgaagctgg tgcggtttgg gacgaaactg       540
     cggaccggac cacacgtcac tggaatgggc gtgagccacg tcggtgtgac cgaagtgccc       600
     aacattgacg attcgggaga cagtcttcct gccaatccga tgccgaaatc gacatttctt       660
     caagaaaagt ccgaccgggc caagccgagg actcgcgagg ggaaggtgct cgcctaa          717
//

If you have problems or comments...

PBIL Back to PBIL home page