(data stored in ACNUC30630 zone)

EMBL: AE017283.PE380

AE017283.PE380       Location/Qualifiers
FT   CDS_pept        437680..438204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0393"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0393"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82145"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAS1"
FT                   /protein_id="AAT82145.1"
FT                   /translation="MEVKLACGADMNRVWEGATQPLTEHEAECPACQAVRTEALRADQL
FT                   RDDTVAEDAQTKVVVDPLKLSSVWRSYAADLSPRHCVFDDDGGQVEVRETVLAAIVRNS
FT                   LADCEDGRLNRIRFSVPHTPLRLRIDLSVARGVRIPDCAERVRHRISTAMTRELGGRPE
FT                   AIDIIVEDIHV"
     atggaggtga agctcgcttg tggcgcggat atgaaccgcg tttgggaggg agcgacacag        60
     cctctcacag aacatgaggc cgagtgccca gcttgccaag ctgtgcgcac tgaggctctt       120
     cgtgctgatc agctgcgtga cgacacggtt gctgaggatg cgcagaccaa ggtagtcgtc       180
     gatccactga agctaagctc agtgtggagg tcatacgctg ctgacctctc gccgcgccac       240
     tgtgttttcg atgatgacgg cggtcaagtg gaagtccgag aaaccgtgct tgccgcgatt       300
     gtgcgtaaca gccttgccga ctgcgaggac gggagactta atcggattcg gttctcggtg       360
     ccccacaccc cattgagact tcgcattgat ttatctgtcg cgcgaggggt gcggatacct       420
     gattgtgccg agcgggtgcg tcaccgcatt tcgacggcga tgacccgtga gcttggtggc       480
     cgtccggaag cgatcgacat catcgtggag gatatccatg tctga                       525
//

If you have problems or comments...

PBIL Back to PBIL home page