(data stored in ACNUC30630 zone)

EMBL: AE017283.PE40

AE017283.PE40        Location/Qualifiers
FT   CDS_pept        42398..42907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0046"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0046"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81805"
FT                   /db_xref="GOA:Q6ABS8"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABS8"
FT                   /protein_id="AAT81805.1"
FT                   /translation="MIRPFHGRALLPQDRIDQIRYRRCNACQNRRHWCCRGAVAVEAAL
FT                   ILPALLMIAAVATGSWRISEVKADAQSAAQVAARAGSVASSVGEGIAVGQRVGLAELAG
FT                   TRCSNPAIAVDSSDLTLPVGFAGTASARVSCTIKLSDLLVPGMPGSFHIESVAHSTLDS
FT                   HRERYS"
     atgatccggc ctttccatgg gcgagcgctg ttgcctcaag accgcatcga ccagatacgg        60
     tatcgacgct gcaacgcctg ccagaacaga cgccattggt gctgccgggg agcggtcgcg       120
     gtcgaagccg cactgatctt gcccgctctg ctcatgattg ccgcggtggc cacgggaagc       180
     tggcgaattt ctgaagtaaa ggccgacgct caatcggctg cccaagtcgc tgcacgggct       240
     gggtcagtag cctcgtcggt tggcgagggc attgcggttg ggcagcgcgt tggtctggct       300
     gagttggctg gcaccaggtg cagtaacccc gcaattgctg tggattcatc tgaccttacg       360
     cttcctgtcg ggttcgctgg caccgcatca gcacgagtaa gttgcaccat caaactgtct       420
     gaccttctcg tcccgggaat gccggggtcc ttccacatcg agtcggtggc ccactccacc       480
     ctcgacagcc atcgggagcg atactcatga                                        510
//

If you have problems or comments...

PBIL Back to PBIL home page