(data stored in ACNUC30630 zone)

EMBL: AE017283.PE404

AE017283.PE404       Location/Qualifiers
FT   CDS_pept        461019..462047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0418"
FT                   /product="cobalamin biosynthesis CobD/CbiB protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0418"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82169"
FT                   /db_xref="GOA:Q6AAP7"
FT                   /db_xref="InterPro:IPR004485"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAP7"
FT                   /protein_id="AAT82169.1"
FT                   /translation="MSITPRRHVAVGLLCRAAGLGLGIIADHIVPDPQTHHPVAVFGAA
FT                   VARLEKTMYADSTRRGTLFTVTCLTPLAVIGGAVDRLTRNRPALRIATTALATWAVVGS
FT                   ASLAREGRAMAGHLANGDLVAARKRLPHLCGRAPDALDAAEIARGAVESMAENASDAAV
FT                   ASLWWGAVAGLPGLLVHRGANTLDAMIGHHNDRYEHFGKVAAYLDDVVNWVPARFTGAL
FT                   AAGCASTVGGDRKTTWRVVRAEHGHHPSPNGGWCESAWAAALGVQLGGRNVYYGNRVEF
FT                   RPLLGSGTRPDADKTADAARLVTTVTTAATWCAVAGLASVAHVLFYGGLIPRGLLPHST
FT                   RR"
     atgtcgatca cgccacgccg ccacgttgcc gtcggtctgc tctgccgggc tgctggtctg        60
     gggctgggca ttatcgccga ccacatcgtg cctgacccgc aaacccacca tccggtggcc       120
     gtcttcggtg cggcggtcgc ccggctagaa aagaccatgt acgcggattc gacgcgacgc       180
     gggaccctct ttactgtcac ctgcttgacg ccgcttgcgg tgatcggagg cgccgttgat       240
     cgcctcaccc gaaaccgacc ggcgctccgt atcgccacca ccgccttggc cacgtgggcc       300
     gtcgtcgggt ccgcatctct ggctcgcgaa ggccgggcga tggccggcca tttggccaat       360
     ggcgacctgg ttgccgcgcg gaagcgtcta ccgcacctgt gtgggcgtgc ccctgacgcc       420
     ctcgacgccg ccgagatagc ccggggcgcc gtcgagtcga tggccgagaa cgcctccgac       480
     gccgcagtcg catcgctctg gtggggcgcg gtcgccgggt tgcctgggct gctcgtccac       540
     cgcggggcca acacccttga cgccatgatc ggccaccata acgaccgcta cgagcacttc       600
     ggcaaggtgg ccgcttacct cgacgacgtt gtcaactggg tgccagctcg gttcaccgga       660
     gccttggccg ctgggtgtgc ctcaacggtc ggaggcgatc ggaaaactac atggcgagtg       720
     gtgcgggccg agcatggcca ccatcccagt cccaacggtg gctggtgcga gtcggcctgg       780
     gcagcggccc tcggtgttca actcggcgga cgtaacgtct actacggcaa ccgggtggag       840
     ttccgcccct tactggggtc cgggacccgt cccgatgctg acaagacggc cgacgcggcg       900
     cgcctggtca ccacggtcac cacggcagcc acctggtgtg ctgtcgcagg gctggccagt       960
     gtggcccatg tgctgttcta cggcggcctg attccgcgcg gtcttctgcc gcacagcaca      1020
     aggcgttga                                                              1029
//

If you have problems or comments...

PBIL Back to PBIL home page