(data stored in ACNUC30630 zone)

EMBL: AE017283.PE42

AE017283.PE42        Location/Qualifiers
FT   CDS_pept        complement(45713..47125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0048"
FT                   /product="conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0048"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81807"
FT                   /db_xref="GOA:Q6ABS6"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABS6"
FT                   /protein_id="AAT81807.1"
FT                   /translation="MDPPRVFFGSPFRIDRGQPEGDHVFWQNLRHLWRRRDFRKILGVR
FT                   VATQAADGTLQVGMASYVLLSPEQQPDAWSIAMVLAITLLPFSIIGPFVSVVLDRWSRQ
FT                   RILVYTDGLRCLIAVGLGILVWNGARDKPSHLALLIGLLIAMSLNRFLLTALVAGLEYT
FT                   IDKRDYLTASSIMPTIGPLGLMIGAVVAAAVRMIAGRHIPVHHADTIIFCISAALFAVS
FT                   VALGLQFSRRELGPPPVDRSRTMRAVAGDVVDGFRYLGKVPLVGHSLTLIGAQRVLFGV
FT                   YSVAMILGYRNRFHVQSDINGAMADMTVWAVAMGAGFVLSAGFMPVLVHRLGMRRALMA
FT                   LLTATAVIQAFPGATPNRWGLLVAGFFVGLFAQSLKAGVDTICQAHITDGYKGRVFIAY
FT                   DMVYNAMFVAGSALAALVLPIQGLSGPHIVGLAIAYAVVAVVFALTTRAHGNDVFDKGS
FT                   ALGGLPAANPEE"
     gtggatcccc cgcgagtgtt cttcggttca ccctttagga tcgatagagg ccagcccgaa        60
     ggagaccatg tgttctggca gaacctgcgc cacctgtggc gacgccgcga cttccggaag       120
     attctcgggg ttcgtgtagc tacccaggcg gctgacggca cccttcaggt cgggatggct       180
     tcctacgttt tgctctcccc cgagcagcag cctgacgcgt ggtcgatcgc catggtgctg       240
     gctatcacct tgctgccctt cagcatcatt ggccccttcg tctccgttgt actcgaccgt       300
     tggtcgcgtc agcgcatcct cgtctatacc gatggtctgc gctgcctcat tgcggtcggg       360
     ctggggatct tggtctggaa tggtgcgcgc gataaaccct cccacctggc cttgctcatc       420
     gggttactca tcgcgatgag cctgaaccgg ttcttgctca ccgccttggt cgctgggttg       480
     gagtacacca tcgacaagcg cgactacctg acggcgtcgt cgatcatgcc gacgattggc       540
     ccgctcgggc tcatgattgg tgccgttgtt gcagcagcag tgcgcatgat tgccggacgc       600
     catatccctg tacaccacgc cgatacgatc attttctgta tttccgcagc cctcttcgca       660
     gtttcggtcg ccttggggct gcagttttca cgtcgggagc ttgggccgcc accggtggat       720
     cgttctcgga cgatgagagc ggtggctggg gatgtggtgg atgggttccg ctacctaggg       780
     aaagtgccac tggtggggca ctccctcacg ctgattggcg cccagcgggt gctgttcggg       840
     gtgtattcgg tggcgatgat cttggggtac cgtaaccgat tccacgtgca gtctgacatc       900
     aacggagcca tggcagacat gaccgtatgg gccgtagcta tgggggccgg cttcgtgctc       960
     tcggcaggct tcatgcccgt gttggtgcat cggctaggaa tgcgtcgtgc ccttatggcc      1020
     ctcctcaccg cgaccgcagt catccaggct ttcccaggcg ccaccccgaa ccgttggggt      1080
     ctgctcgtgg ctggcttttt cgtcgggcta ttcgcccagt ctctcaaggc cggtgtcgac      1140
     accatttgcc aggcacacat cactgacggt tacaagggcc gtgtgttcat cgcttacgac      1200
     atggtgtaca acgcgatgtt cgtggcaggt tcagctttgg ctgcattggt gctgcctatc      1260
     cagggactgt ccggcccaca catagtcggc ctggccatcg cctacgccgt ggtggctgtg      1320
     gtcttcgcgc taactacccg ggcccatggt aacgatgtct tcgacaaagg tagtgccctc      1380
     ggtgggttgc ccgccgctaa ccccgaagaa tga                                   1413
//

If you have problems or comments...

PBIL Back to PBIL home page