(data stored in ACNUC30630 zone)

EMBL: AE017283.PE420

AE017283.PE420       Location/Qualifiers
FT   CDS_pept        477344..478189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0433"
FT                   /product="cobalt transport protein CbiQ"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0433"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82185"
FT                   /db_xref="GOA:Q6AAN1"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="InterPro:IPR012809"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAN1"
FT                   /protein_id="AAT82185.1"
FT                   /translation="MTITSLDDAAWDSPWRRRPVGEKVALSTALLLTALCTPSMEASRW
FT                   VRSVVGSGIWPGALLAGIVSVIVVLGPARIAGRVLWQAVVAPLVFLVIGGISVLVSLGS
FT                   TPVGTVWWHAGAFSIGPVSSAQAMSLIEHGVCGTLALMVLAVTTPMVDLLTWLRKFHIP
FT                   DPLLEIASLTYRLIFVLLDTVVTASEAQHARLGDTPAGRFGGFNRRMNNTAALLGSVGI
FT                   RAWARANRLNDGLVNRGFEAALATLPIKRTGSVRYKIIVVIVIAVLWVISWTTTGRIFR
FT                   "
     atgacaatta cctctctcga cgacgccgcc tgggattccc cctggcggcg tcgcccggtc        60
     ggggaaaaag tcgccctatc gacggccctg ctcctgactg ccctgtgcac tccgtcaatg       120
     gaggcttcgc ggtgggtgag gtcggtggta ggttctggta tttggcccgg ggcgctgttg       180
     gctgggatcg tcagtgtgat cgtcgtcctg gggccagccc gcattgctgg acgggtactg       240
     tggcaggcag ttgtcgcccc gctcgtcttt ctcgtcatcg gcggcatctc cgttctcgtc       300
     agccttggat ccaccccggt tggaacggtt tggtggcatg ccggggcgtt tagcatcgga       360
     cctgtttcca gcgcccaggc gatgtccctg atcgaacacg gcgtatgcgg caccctcgcc       420
     ctcatggtgc tggcggtcac cacgccgatg gttgatctcc taacctggct tcggaaattc       480
     cacatccctg atccgttgtt ggaaatcgcc tctttgacct accgactcat cttcgtgcta       540
     ctcgataccg ttgtcacagc cagcgaggcc cagcacgccc gccttggcga taccccggcc       600
     ggacgattcg gcgggttcaa tcggcgcatg aacaacacgg ccgctctgct gggatcagtc       660
     ggaatccggg catgggcgag ggctaaccgt ctcaacgatg gactcgttaa tcgcggcttc       720
     gaggccgcgc tggccacctt gcccatcaaa cgcaccggtt cggtgcgata caagatcatc       780
     gtcgtcatcg tcatcgctgt cctgtgggtg atcagttgga cgacgaccgg aaggattttc       840
     agatga                                                                  846
//

If you have problems or comments...

PBIL Back to PBIL home page