(data stored in ACNUC30630 zone)

EMBL: AE017283.PE436

AE017283.PE436       Location/Qualifiers
FT   CDS_pept        495192..495638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0449"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0449"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82201"
FT                   /db_xref="GOA:Q6AAL5"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAL5"
FT                   /protein_id="AAT82201.1"
FT                   /translation="MVVSKKFDDLLGMLGAIVFFLVIVILVMAPFIMIPVLFALVFQEC
FT                   YLDSPWTWETVVLGGLVLFALGMGVSLLMGVLARVVAPLTHPVVNRVFKEILEFLVLWW
FT                   FYSTLMHPTSYAFWASIVVMIMTTVTEPILDRAIERQKHAPNQP"
     gtggtagtat ctaagaaatt cgatgatttg ctggggatgt taggcgcaat tgtctttttt        60
     ctcgtcatcg ttattcttgt tatggccccc ttcattatga ttccagtgtt gttcgccttg       120
     gtatttcagg agtgctatct agattcgccg tggacatggg agactgttgt cctgggtgga       180
     ttagtgctgt ttgcactggg gatgggtgtt tccctgctca tgggggtgtt ggcgagggtc       240
     gtcgccccct tgactcatcc tgtggtcaac agggtcttta aagagattct tgagttcctt       300
     gtgctttggt ggttttattc cactctcatg cacccgacta gctatgcttt ttgggcgagc       360
     attgtggtga tgattatgac cactgttacc gaacccattc tcgatagggc catcgaacga       420
     cagaagcacg cccccaacca accttga                                           447
//

If you have problems or comments...

PBIL Back to PBIL home page