(data stored in ACNUC30630 zone)

EMBL: AE017283.PE45

AE017283.PE45        Location/Qualifiers
FT   CDS_pept        complement(49651..50181)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0051"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0051"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81810"
FT                   /db_xref="GOA:Q6ABS3"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABS3"
FT                   /protein_id="AAT81810.1"
FT                   /translation="MRRMLFAVTKFKRVMALLGVIYLVTVGGLYFVLADRSDNFIHDGQ
FT                   IIQGTVTAVYSHRSVSTGATKYLMHAEGGNVALISYTYDGATDTVWSNPYRDIKKYHVG
FT                   QKVDLVIRATPNHPDDAIVTVRDHTILGLRLIPWGFLASAVIMTAWFGRDYLRSKRRRR
FT                   LGGQRHAPAAVEA"
     gtgcgacgta tgctgttcgc tgtgacgaag ttcaagcgtg tcatggctct gctcggggtg        60
     atctatctcg tgactgtggg aggcttgtac ttcgtgctag ctgaccgcag cgacaatttc       120
     atccatgatg gccagatcat ccagggaacc gtgacagctg tctactcgca ccgctccgtc       180
     agtaccggtg ctaccaagta cctcatgcat gccgagggcg gcaatgttgc gctcatttcg       240
     tacacctacg acggggcgac ggatacggtc tggtcgaacc cctaccgtga catcaagaaa       300
     taccacgtgg gtcagaaggt cgatctagtg atccgagcca caccgaacca tccggatgac       360
     gccatcgtga cggtgcgtga ccacaccatc ctgggcttgc gtctcattcc ttggggattc       420
     ctcgccagcg ccgtcattat gacggcatgg ttcggacgtg actacttgag gtccaagaga       480
     cgccgtcgac taggtggtca gcgtcacgcc ccggccgccg tcgaagccta a                531
//

If you have problems or comments...

PBIL Back to PBIL home page