(data stored in ACNUC30630 zone)

EMBL: AE017283.PE473

AE017283.PE473       Location/Qualifiers
FT   CDS_pept        536291..537352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0486"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0486"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82238"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAH8"
FT                   /protein_id="AAT82238.1"
FT                   /translation="MCPSQLPDLDQIAALCESGWYDTADSMLRMAHASESANPHVVQAA
FT                   GVMAVARRVLALDAEDFEDIGEALPADLRSRLVDSGFPHHPRAAERGALGDLIPLYELM
FT                   LEVLDIRMRREEPQQVVVTCHILGEYLAQLAWQPVLGDGGDPLTLPGKVGQKWGGDAQG
FT                   CAHTSAMNATARRSMHAAQGDEEGYTSYLDKFHSRLGEALGVCAMNHATIDAGERPDVG
FT                   ITCPDPCRWVLAGTWEERRALDARVRLARIFQESGLVALRHHAPVGHFFGVPSGSEIGN
FT                   AWVMTWNKLNEQWADGSNPMLDPSAPGYDVDASDGALPGLARMVSVIAARPIRAGHLLR
FT                   DLGVTAIAELKAV"
     gtgtgtccca gccagttgcc ggacctggac cagattgccg ccctctgcga gtcaggctgg        60
     tacgacaccg ccgattccat gttgaggatg gcgcacgcat ctgagtctgc caatcctcat       120
     gtggtgcagg ctgctggcgt gatggcggtg gcccgccgag tcttggctct agatgccgag       180
     gattttgagg acatcggtga ggccttgccc gcggatctgc gatctcgcct tgtcgactct       240
     ggttttccac accacccgcg tgccgcagag aggggagctc ttggggatct catccccttg       300
     tatgagctca tgctcgaggt cctcgacatc cggatgcgtc gtgaggagcc ccaacaagtc       360
     gttgtgacct gccacatcct gggggagtac ttggcgcagt tggcctggca accagtctta       420
     ggcgatggtg gggatccgct caccttgcct ggcaaggttg gccagaaatg gggcggtgat       480
     gctcaaggct gtgcccacac ctccgcgatg aatgccaccg cgcgacgcag catgcatgct       540
     gcccagggag acgaggaggg gtatacctcg tacctcgaca agttccactc ccggttgggg       600
     gaggccctcg gagtgtgcgc gatgaatcat gccactattg atgccggtga gcgtcccgac       660
     gttggtatca cttgccctga cccatgtcgg tgggtcttag ccggaacctg ggaggagcgc       720
     agagcccttg acgcgcgggt gcgcctggca cggatttttc aagagtccgg tctagtggct       780
     ctgcgccatc acgctccggt aggccatttt ttcggggtgc catcgggcag cgagatcgga       840
     aatgcttggg tgatgacgtg gaataagctc aacgaacagt gggctgatgg ttccaacccg       900
     atgctagacc cgtcggcccc cgggtatgac gttgacgcct ctgatggggc cctgcctggc       960
     cttgcccgga tggtgtcggt catcgctgcg cggccgattc gagctggcca tttgctgcgg      1020
     gatctgggag tcaccgcgat tgccgaattg aaggcggttt ga                         1062
//

If you have problems or comments...

PBIL Back to PBIL home page