(data stored in ACNUC30630 zone)

EMBL: AE017283.PE480

AE017283.PE480       Location/Qualifiers
FT   CDS_pept        complement(543115..543417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA2407"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA2407"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82245"
FT                   /db_xref="InterPro:IPR013429"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAH1"
FT                   /protein_id="AAT82245.1"
FT                   /translation="MPTYQYQCNDCGRDLEVVQRFSDPSLTICPSCEGDLRKVFSAVGV
FT                   VFKGSGFYSTDNHTKGASKAATGDSSSPTALESSTKSEPASSSSSSTAKASESAS"
     atgcccacct accaatacca atgcaatgac tgcggccgtg acctcgaggt tgtgcaaagg        60
     ttcagcgacc cgtcgttgac tatctgcccg tcctgcgagg gtgatctgcg caaggtcttc       120
     agcgcggtcg gggtggtttt caaaggttca gggttctact ccaccgacaa tcacaccaag       180
     ggcgcatcaa aggcagccac cggggatagc tcttcgccaa cggccttaga gtcctcgacg       240
     aagtctgaac cggcctcgtc ctcatcttcc tcgacggcga aagcctccga gagcgcatcc       300
     tga                                                                     303
//

If you have problems or comments...

PBIL Back to PBIL home page