(data stored in ACNUC30630 zone)

EMBL: AE017283.PE486

AE017283.PE486       Location/Qualifiers
FT   CDS_pept        complement(548485..548970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0498"
FT                   /product="molybdenum cofactor biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0498"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82251"
FT                   /db_xref="GOA:Q6AAG5"
FT                   /db_xref="InterPro:IPR002820"
FT                   /db_xref="InterPro:IPR023045"
FT                   /db_xref="InterPro:IPR036522"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAG5"
FT                   /protein_id="AAT82251.1"
FT                   /translation="MTSHPFTHLRGNGSAHMVDVTTKTPTVRVATAECCVVCSEPIMTA
FT                   LRDESVPKGDVLAVARIAGIQATKHTPDLIPLAHRIGVHGAEVDLWLEPDRVRIRATTR
FT                   TTDRTGVEMEALTAVTVAALTVADMVKGVDRGFAIEHAVITHKAGGRSGEWTRSDDQ"
     atgacctcac acccattcac ccacctgcgt ggtaacggat cggctcacat ggtcgacgtc        60
     acgacaaaga cacccacggt gcgcgtggcg acggcggaat gctgcgtggt gtgctccgag       120
     ccgatcatga ctgccctgcg cgacgaatcg gtccccaaag gggacgtcct cgccgtggcc       180
     cgcatcgcag gtatccaggc caccaagcac actccagacc tcatccccct ggcgcaccgc       240
     atcggtgtgc acggggcaga agtggacctg tggctggagc ctgaccgggt gaggatccgt       300
     gccacaaccc gtaccaccga tcgcaccgga gtggagatgg aagcgctcac cgctgtgacg       360
     gtggctgccc tcaccgtcgc cgacatggtc aagggagtcg atcgcggctt cgccatcgag       420
     cacgcggtga tcactcacaa agccggtgga cgcagcggcg agtggaccag gagcgacgac       480
     caatga                                                                  486
//

If you have problems or comments...

PBIL Back to PBIL home page