(data stored in ACNUC30630 zone)

EMBL: AE017283.PE492

AE017283.PE492       Location/Qualifiers
FT   CDS_pept        552649..553419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0504"
FT                   /product="putative molybdate-binding protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0504"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82257"
FT                   /db_xref="GOA:Q6AAF9"
FT                   /db_xref="InterPro:IPR005950"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAF9"
FT                   /protein_id="AAT82257.1"
FT                   /translation="MSRVSLRTCAIAAVAAVLLAACGSGPSSTQPSAAPTRLTVFAAAS
FT                   LTRSYEQIGEQFERKYPRVDVQFSFEGSQNLVAQMAQGAPADVLATADQRSMNKAVEQN
FT                   LVNVPRQFASNVLTLVTPAHNPARVTGLNSSLRGAKLVICAPEVPCGNATRKLANKLGV
FT                   TLKPVSEEQKVTDVRGKVESGEADVGIVYRTDALAAGNKVDVIPIGRANEVVNHYPIAT
FT                   AVGATHQGLAKRFVEYVMSADAQKILSDDGFSGP"
     atgtcaagag tctcgctgcg gacctgcgcc attgcagcag tagcagcggt gttgcttgcg        60
     gcgtgcggca gtgggccgtc ttctacccag ccctcggcag ccccgacgag gttgaccgtc       120
     tttgccgctg cgtccctcac aaggtcctac gagcagatcg gcgagcaatt tgagcgcaag       180
     tatccccggg tcgacgtgca gttttccttt gaagggtccc agaacctggt cgcccagatg       240
     gcccaggggg ccccggctga tgtcctggcc accgctgatc aaaggagcat gaacaaagcg       300
     gttgagcaga acttagtgaa tgtcccacgt cagttcgcca gcaacgtgct cacccttgtt       360
     acccctgcac ataatccggc gagggtgacc ggattgaact cttcgctgcg tggcgccaag       420
     cttgtcatat gcgccccaga ggtgccctgc ggcaacgcga cgaggaaact cgccaacaag       480
     ctgggcgtca cgttgaagcc ggtgagcgag gaacagaagg tcactgatgt tcggggcaaa       540
     gttgagtctg gggaagccga tgtggggatc gtctatcgca cggacgcgct cgcggctggc       600
     aacaaagtgg acgtgatacc gatcggtcga gccaatgagg tcgtcaatca ttacccgata       660
     gcgaccgcgg tcggcgccac ccaccagggc ctggctaaaa ggttcgtcga gtacgtgatg       720
     tcggctgatg cccagaagat cctctcggat gatgggtttt ccgggccgtg a                771
//

If you have problems or comments...

PBIL Back to PBIL home page