(data stored in ACNUC30630 zone)

EMBL: AE017283.PE495

AE017283.PE495       Location/Qualifiers
FT   CDS_pept        complement(556013..556726)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0507"
FT                   /product="nitrate reductase gamma subunit"
FT                   /EC_number="1.7.99.4"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0507"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82260"
FT                   /db_xref="GOA:Q6AAF6"
FT                   /db_xref="InterPro:IPR003816"
FT                   /db_xref="InterPro:IPR023234"
FT                   /db_xref="InterPro:IPR036197"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAF6"
FT                   /protein_id="AAT82260.1"
FT                   /translation="MNTNLLVWLVLPYLSIILLIGGMIWRYRTDQFGWTSRSSQWNEPS
FT                   ILRWSSPLFHFGILFVFLGHVLGLVIPQSWTSTIGITEDTYHVMATVLGSAAGLAALVG
FT                   LLGLLYRRFMTKSVRLTTTTMDIVTYVLLTLTVTLGCWATVHQQMIVGGYNYRDTIGPW
FT                   FRSIALFQPRPELMATVPLDYKLHVMAGMVLFSVWPFTRLVHVVSAPVSYPTRPYVIYR
FT                   SKNGHLGSSSRHYGW"
     gtgaacacaa atctattggt atggctggta ctgccttatc tgtcgatcat cctcctcatc        60
     ggagggatga tctggcggta ccgcactgat cagttcggat ggacgagccg atcaagccag       120
     tggaacgagc cgtccatcct gcgctggtcg tcaccactgt tccacttcgg gatcctcttc       180
     gtctttctgg gacacgtctt gggacttgtc atcccccagt catggacttc caccatcgga       240
     atcaccgagg acacgtatca cgtcatggcg accgttctgg ggagtgcagc cgggctggcg       300
     gccctcgtcg gactcctcgg gctgttgtac cgcaggttca tgacaaagtc ggtgcgcctc       360
     acgacaacca ccatggacat cgtcacctat gtgctgctca ctctgacagt cacgctgggg       420
     tgctgggcca ccgtacacca gcagatgatt gtcggcggct acaattaccg cgatactatc       480
     ggtccatggt tccgctccat cgcgctgttt cagcctcgac cagaactaat ggccacggta       540
     ccattagatt ataagctaca tgttatggct gggatggtcc tgttcagcgt atggccattc       600
     actcggctgg tgcacgtcgt ttctgcacca gtaagctacc cgacaaggcc atacgtcata       660
     tacaggtcca agaacggcca tctgggatct tcatcgcgac actacggatg gtga             714
//

If you have problems or comments...

PBIL Back to PBIL home page