(data stored in ACNUC30630 zone)

EMBL: AE017283.PE509

AE017283.PE509       Location/Qualifiers
FT   CDS_pept        complement(574652..574966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0521"
FT                   /product="conserved protein, putative metal-transport (Mg2+
FT                   and Co2+) protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0521"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82274"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAE2"
FT                   /protein_id="AAT82274.1"
FT                   /translation="MDGHPERLGIIVEQSPNRTQIKRLVDPMNLDPLLAEDLAEGHQRP
FT                   KLERHGEALFLVLHPPFYIDSIEDVAFVEAEVIKQRNCVVPTLIGSIYSMNFDNMPELH
FT                   "
     ttggacggcc atccggaacg tctaggaatc atcgtcgaac agagccccaa ccgcacccag        60
     atcaagcggt tagttgatcc gatgaacctc gacccgctgc tggctgaaga cctcgccgaa       120
     ggccatcaac gacccaagct ggagcgccat ggcgaggccc tgttcctggt gctacatccg       180
     ccgttctaca tcgattcgat cgaggacgtc gcctttgttg aggccgaagt cattaagcag       240
     cgcaattgcg tcgtccccac cctcataggg tcgatttata gcatgaactt cgacaacatg       300
     ccagagctac actga                                                        315
//

If you have problems or comments...

PBIL Back to PBIL home page