(data stored in ACNUC30630 zone)

EMBL: AE017283.PE537

AE017283.PE537       Location/Qualifiers
FT   CDS_pept        602792..603625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0549"
FT                   /product="membrane spanning protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0549"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82302"
FT                   /db_xref="GOA:Q6AAB4"
FT                   /db_xref="InterPro:IPR010539"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAB4"
FT                   /protein_id="AAT82302.1"
FT                   /translation="MANPVFSRAEAFQPRGNPYGQPAYAGQGYRAQYGVSGQPGGESGS
FT                   LLDGPQGQSAERAMTFDDVLGRTGLVLLIIAAIGAVSFALIGPNVVASGPALVVGSIAA
FT                   FITAMVVSTRRTVPVGGVIFYCICEGLVLGSMSAMFETAYPGIVVQAVLGTFAAAGVTL
FT                   AAYKFFNIRVTPRFRQIVIISTFGFALAMLVNLVLILFRINIGVASFGPIGILCSALGV
FT                   VLAAMNLVVDFDYAEQGVRNQAPASESWRAAFGIAVTMVWLYTEILRILSYFRAD"
     atggctaacc cggtctttag ccgagccgag gccttccagc cgcgcggtaa cccgtacggg        60
     cagccggcgt acgcaggtca ggggtatcgg gcgcagtacg gcgtatcagg gcagcctggc       120
     ggcgagtcgg gctctctatt agacggcccg caaggacaga gtgccgagcg cgcgatgact       180
     tttgatgacg tcctcggccg tactggcctg gttctgctca tcattgctgc cattggtgct       240
     gtgagcttcg cgctgattgg gccgaacgtg gtggcaagtg gccctgcctt ggtggtcgga       300
     tcgattgcag cattcattac tgcgatggtc gtcagcactc gccgtacggt gccggtcggt       360
     ggcgtcatct tctactgcat ctgcgaaggg ctggtccttg gctctatgtc agccatgttt       420
     gagaccgctt accccggtat cgtggtgcag gccgtcttgg gtactttcgc cgctgccggc       480
     gtgaccttgg cggcatacaa gttctttaat atccgggtga cgccgcgatt tcgtcagatc       540
     gtcatcattt ccaccttcgg ctttgccctt gcgatgctcg tcaacctcgt gttgatacta       600
     ttcaggatca acattggcgt tgctagtttt ggccctatcg gcatcttgtg ctcagcgctg       660
     ggtgtggtgc tggccgccat gaaccttgtc gtagattttg actacgccga gcagggtgtg       720
     cgcaaccaag ccccagcatc tgagtcttgg cgtgcggcct tcggcatcgc tgtgacgatg       780
     gtgtggctct acacagagat cttgcggatt ctcagttact tccgggctga ttga             834
//

If you have problems or comments...

PBIL Back to PBIL home page