(data stored in ACNUC30630 zone)

EMBL: AE017283.PE542

AE017283.PE542       Location/Qualifiers
FT   CDS_pept        complement(612064..612201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA2402"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA2402"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82307"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AAA9"
FT                   /protein_id="AAT82307.1"
FT                   /translation="MNRQASSRERAGNRTPGNLSSPDAPRTCYHKPILAALSRIVVTDR
FT                   "
     gtgaaccgtc aagcatcctc tcgcgaacgc gcggggaaca gaacgccggg gaacctttct        60
     agcccggatg cgcctcgcac ttgttaccac aaacctattc ttgcagccct atcaaggatc       120
     gtcgtcaccg atcggtaa                                                     138
//

If you have problems or comments...

PBIL Back to PBIL home page