(data stored in ACNUC30630 zone)

EMBL: AE017283.PE553

AE017283.PE553       Location/Qualifiers
FT   CDS_pept        622629..624644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0563"
FT                   /product="conserved protein containing thioredoxin domain"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0563"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82318"
FT                   /db_xref="GOA:Q6AA98"
FT                   /db_xref="InterPro:IPR004879"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR024705"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AA98"
FT                   /protein_id="AAT82318.1"
FT                   /translation="MPNYLGESTSPYLIQHAANPVDWFPWGEEAFDEARSRDVPVMVSV
FT                   GYSSCHWCHVMALESFSDPEVAEVVNANVVPVKVDREERPEVDAALMQVTLAMTGQGGW
FT                   PNTVFLTPEGKPFFAGTYFPPVRRGRLPGFVELVEALGGAWRERRDEVVSSAEAIVEHL
FT                   RPVEKDPEVARPIAGELIDAVGADYDIVHGGFGSPTKFPMPTLLDALLVKGDPTSLDMA
FT                   QNTCEHLVRGGIFDQVGGGFHRYSTDSQWVVPHFEKMLYDNALLLATMARCWRRTADHD
FT                   SDRRDLYSHAARRTVAWLNREMRLPNGLYAAGLDADSDDAAGHTHEGIYYLWNQDLITD
FT                   ALGTDEAEWLRPLVHLEPCNDNGLGTLQLRGRVEWERINADMDTLLEARGRRSAPARDE
FT                   KAITAWNAMLIDGLVEAGMILREWSWVEQARELADSLWTAHWDHGMALRTSFHDRPGVP
FT                   AVCEDYAWVALSFAGLAGATGESVWLDHAVEVLGEAVARFSAVDGSFLDAEDSFLLTVT
FT                   AHTLTDDACPSPTAAMVMALRRVGLMAERADFIERANKASVVLLPVVSATPRFAGWAVA
FT                   DFLITDEARRGLKPAGVVIADTTDEPSDLAAAAWRMAPAGSAIMRRLNEDSGFGTWFNE
FT                   RVPRDGQPTCWVCRGAVCFEPVTDYLDLKEPLWRRA"
     atgcctaatt accttggcga gtccaccagc ccgtacctta tccagcacgc cgcgaatcct        60
     gtcgactggt tcccctgggg agaagaagcg ttcgacgagg cccgtagtcg ggacgtgcct       120
     gtcatggttt cagtgggcta ctcgagctgc cactggtgcc acgttatggc gctggagtct       180
     ttcagcgacc cggaggtggc tgaggtcgtc aacgccaatg tcgtccccgt taaggtcgat       240
     cgagaggagc gccccgaggt cgacgcggcg ctgatgcagg tgaccttggc gatgaccggc       300
     cagggtgggt ggcctaatac cgtgttcctc actcctgagg gcaagccatt ctttgccgga       360
     acctactttc cgccggtgcg ccgtggcagg ttgccggggt tcgtcgagct cgtggaagct       420
     ctcggtgggg cgtggcgtga gcgtcgtgac gaagtggtgt cttccgcgga ggcaatcgtc       480
     gagcacctgc gccctgttga gaaggacccc gaggttgccc gtccgatcgc tggggagctc       540
     attgacgctg tcggagccga ctacgacatc gtccacggcg gtttcggaag tccgacgaag       600
     ttcccgatgc ccaccctgct cgacgccttg ctcgtcaagg gcgacccgac cagcctcgac       660
     atggcccaga acacgtgtga gcatttggtt cgcggtggca ttttcgacca ggtcggtggc       720
     ggattccacc gttactccac cgactcacaa tgggtggtgc cgcactttga gaaaatgctc       780
     tatgacaatg ccctgttact ggcaacgatg gcccgttgtt ggcgtcgcac tgccgaccac       840
     gactccgatc gccgtgatct gtactcccac gccgctcgtc gcaccgtagc atggctcaat       900
     cgagagatgc ggctgcccaa cggtctgtat gccgccggtc tggacgccga ttccgacgat       960
     gccgctggac acactcacga gggcatctac tacctatgga atcaagatct gattacggac      1020
     gcattaggaa ccgacgaggc cgagtggctg cgccccctcg tgcatctcga gccttgtaac      1080
     gacaacggtt tgggcactct acagctgcgc gggcgcgtcg agtgggagcg cattaacgcc      1140
     gacatggaca ctttgctcga ggcccggggg cgtcgcagtg cccctgctcg tgacgaaaag      1200
     gcgatcacag cgtggaacgc catgctcatt gacggtctcg tcgaggccgg catgatcctg      1260
     cgcgaatggt catgggtgga gcaggcccgc gagctcgccg actcgttgtg gaccgcgcat      1320
     tgggatcacg gcatggcact gcgcacttct ttccacgatc gtccgggagt tccggcggtg      1380
     tgtgaggatt acgcttgggt cgcgctgtcc tttgctggct tggccggggc aacgggggag      1440
     tcggtgtggc tagatcatgc cgtcgaggtg cttggcgagg cggttgctcg attcagcgct      1500
     gtcgatggca gttttcttga cgccgaggat tcattcctgc tgacggtgac cgctcacacg      1560
     ctgactgacg acgcctgccc cagcccgacc gcggccatgg tcatggccct gcgcagagtg      1620
     gggctcatgg ccgagcgtgc cgatttcatc gagcgtgcca acaaggcctc cgtggtccta      1680
     cttccagtgg tgtcagcaac gccgcgattc gccggttggg ccgtggcaga cttcctcatt      1740
     actgacgagg cccgtcgtgg tctcaagccg gcaggagtcg ttatcgcgga tacgaccgac      1800
     gagcctagtg acctggccgc tgcggcgtgg cgaatggccc cagcagggtc agcgatcatg      1860
     cgtcgactta acgaggactc tgggtttggc acttggttca acgagcgcgt cccgcgtgat      1920
     ggtcaaccga cctgttgggt atgccgcggc gcggtgtgct ttgagccggt aaccgactac      1980
     ctggacctca aagaaccgct ctggcggcga gcctga                                2016
//

If you have problems or comments...

PBIL Back to PBIL home page