(data stored in ACNUC30630 zone)

EMBL: AE017283.PE561

AE017283.PE561       Location/Qualifiers
FT   CDS_pept        complement(631516..632787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0571"
FT                   /product="protein with WD40 domain"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0571"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82326"
FT                   /db_xref="InterPro:IPR011045"
FT                   /db_xref="InterPro:IPR011964"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR019405"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AA90"
FT                   /protein_id="AAT82326.1"
FT                   /translation="MPFLFPKFWVMSAPHDTHVSRRLRRGLASACAVVTAIAAFSPAHA
FT                   APSPNKAGPMSGSTGRTTVGQLLTPAGQLTTLGDLPLNEALSPDGRYLIVSNNGQGTQS
FT                   LQVIKTATGKVVQTIPYKSPESLYMGLAFSPDGTHLFASAAGNHKIRTYHFDCGKLVET
FT                   SAIQMPVVSPKLTKVNLYPAGLAVTNDSKRLVVADQLADAVSVIDLATNKIQTTHIGHR
FT                   PVWVTLSKDSTKAFVSSQGGADVAEVDITKSQPLATHKINVGFHPNKSVLTPDGKSLYV
FT                   ANGDADTISVVDVASHRQTATIPVNRNGSKLVGANPTGLALSQDGKRLYVTNSGHNEVA
FT                   VINAATRKVIGDIPTGWYPTQVLAHDGKLSITSAKGLGAGPNNGPGHPNPTDPRDTAEN
FT                   QYSGSMIKGLLSTVNGMTQRPWPS"
     gtgccatttt tatttcctaa gttctgggtt atgagcgctc ctcatgacac acacgtatcc        60
     agacgactgc gccgaggtct cgcctcggcg tgtgccgttg ttaccgcaat agcagccttc       120
     tccccagctc atgcggctcc gtctcccaac aaggccgggc cgatgtcggg ttctactggc       180
     cgcactaccg tcggtcagct gctgactcca gccggtcagc tcaccaccct tggtgacctc       240
     ccgctcaatg aggctttatc ccccgatggc aggtacctca tcgtcagcaa taacggtcag       300
     ggaacccagt ccctgcaggt catcaaaact gccactggca aggtcgtcca gaccatcccc       360
     tataagtctc ccgaaagcct gtacatgggg ctggccttca gccctgacgg cacgcacctg       420
     ttcgccagcg ctgctggcaa ccacaagatc cgcacgtacc acttcgactg tggcaaactc       480
     gtggaaacca gcgctatcca gatgccggtc gtcagcccga agctcacaaa ggtcaacctg       540
     tacccggctg ggctcgccgt cacgaatgac agcaaacgcc tcgtcgtggc agatcagctc       600
     gctgatgccg tctccgtcat cgacttggcc accaacaaga ttcagacgac ccacatcggg       660
     caccgcccgg tctgggtgac cctctccaag gactccacca aagcgttcgt ctcttcccaa       720
     ggcggggccg acgtcgccga ggttgacatc accaaatccc agccactggc gacccacaaa       780
     atcaacgtag gcttccatcc caacaagtcc gtgctgaccc ccgatggcaa gtccctctac       840
     gtcgctaatg gtgacgccga caccatctca gtggtcgacg tcgcatctca tcgccagacc       900
     gccaccatcc cggtcaaccg caacggttcc aaactggtag gtgccaatcc gaccggtctg       960
     gctctctccc aagacggcaa gcgtctctac gtcaccaact cgggacacaa tgaggttgcc      1020
     gtcatcaacg ccgcaactcg caaggttatc ggggacattc cgactggctg gtacccgacg      1080
     caggtcctcg cccatgacgg caagctgagc atcacttcgg ccaaagggct gggagccggg      1140
     ccgaacaacg gcccgggcca ccccaatccc accgacccgc gcgataccgc cgagaaccag      1200
     tactccggtt ccatgatcaa aggcctgctc tccaccgtca acggcatgac gcagcgaccc      1260
     tggccaagct ga                                                          1272
//

If you have problems or comments...

PBIL Back to PBIL home page