(data stored in ACNUC30630 zone)

EMBL: AE017283.PE575

AE017283.PE575       Location/Qualifiers
FT   CDS_pept        646993..647898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0585"
FT                   /product="carbamate kinase"
FT                   /EC_number="2.7.2.2"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0585"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82340"
FT                   /db_xref="GOA:Q6AA76"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR003964"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AA76"
FT                   /protein_id="AAT82340.1"
FT                   /translation="MRILVALGGNALLRRGETMTAENQRANVRIAANHIKEVAVDHEVV
FT                   VAHGNGPQVGLLALQSTAYEEIGIYPLDVLGAESQAMIGYMIEQELGNVMPQDQQIVTM
FT                   ITMTVVDADDPAFKHPTKPIGPVYDEATARRLAAEKGWTIAPDGEYYRRVVASPQPRNI
FT                   IEQKAIRQLVDSGVMVVCAGGGGVPCVYDEDGILHGAEAVIDKDLASAELAVRVDADLL
FT                   VIATDVAGVFRNWGEPDQERIEQMHASDALNTEFAAGSMGPKVKAACNFALATGKRAVI
FT                   GSLEDIQGLVAGTHGTAIIP"
     atgaggattt tggttgcact tggtggtaac gcgttgctgc ggcgtggcga gaccatgacg        60
     gcggagaatc agcgtgccaa tgtgcgcatc gccgcaaacc acatcaagga ggttgcggtc       120
     gatcacgagg tcgttgtagc ccatggtaat ggcccccagg taggtctgtt ggctctgcaa       180
     tcgacagcct acgaggaaat cggtatctat ccgctggatg tcctgggcgc agagtcacag       240
     gccatgatcg gctacatgat cgagcaggaa ctcggcaatg tgatgcctca ggatcagcag       300
     atcgtcacca tgatcacgat gacagtcgtc gacgcagatg atcctgcttt caagcatccc       360
     acgaaaccga tcggcccggt ctacgacgag gcaactgcca ggcgcctggc ggctgagaag       420
     ggctggacga tagccccgga cggagagtac taccggcgtg tggtcgcgtc cccgcagccc       480
     aggaacatca tcgagcagaa ggcgatccgc cagttggtgg attccggcgt catggtggtg       540
     tgtgccggag gcggcggcgt cccctgcgtc tacgacgagg acggtattct gcacggggct       600
     gaggcagtca ttgacaagga tcttgcgtca gccgaactcg ccgtgcgtgt cgacgcggac       660
     ctgctggtca tcgctaccga tgtggccggt gtgttccgca actggggaga gcctgatcag       720
     gagcgcatcg agcagatgca cgcatcggat gccctcaaca cggagtttgc cgctggctcg       780
     atgggtccga aggttaaggc cgcctgcaac tttgcgttgg ctaccgggaa acgtgctgtg       840
     atcgggtcgt tggaagacat ccaaggtctg gtcgcgggca cgcacgggac tgccatcatc       900
     ccctga                                                                  906
//

If you have problems or comments...

PBIL Back to PBIL home page