(data stored in ACNUC30630 zone)

EMBL: AE017283.PE586

AE017283.PE586       Location/Qualifiers
FT   CDS_pept        659104..661293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0596"
FT                   /product="methylmalonyl-CoA mutase large subunit"
FT                   /EC_number="5.4.99.2"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0596"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82351"
FT                   /db_xref="GOA:Q6AA65"
FT                   /db_xref="InterPro:IPR006098"
FT                   /db_xref="InterPro:IPR006099"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR006159"
FT                   /db_xref="InterPro:IPR016176"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AA65"
FT                   /protein_id="AAT82351.1"
FT                   /translation="MTTLPRFDSINLGDSPVPADAQEQFARLAAAAGEQEPWTTPEQIP
FT                   VGHLYSEDVYGDMDWLDTYAGLPPFTHGPYATMYAFRPWTIRQYAGFSTAKESNAFYRR
FT                   NLAAGQKGLSVAFDLPTHRGYDSDNPRVPGDVGMAGVAVDSILDMRELFAGIPLDRMSV
FT                   SMTMNGAVLPILALYVVTAEEQGAKPEQLAGTIQNDILKEFMVRNTYIYPPLPSMRIIS
FT                   DIFAYTSANMPKWNSISISGYHMQEAGATADIEMAYTLADGVDYIRAGESVGLQVDQFA
FT                   PRLSFFWAIGTNFFMEVAKMRAARMLWAKLVHQFNPKNPKSMSLRTHSQTSGWSLTAQD
FT                   VYNNVIRTCVEAMGATQGHTQSLHTNSLDEAIALPTDFSARIARNTQLFIQQESGTCRV
FT                   IDPWSGSAYVEKLTLELARKAWAHIQEVEKAGGMAKAIEKGIPKMRIEEAAARTQARID
FT                   SGRQPLIGVNKYRLDEEEPLEVLKVDNTQVLKEQKAKLEQLRANRDEEACQAALEKITW
FT                   AAANPDPSDPDRNLLKLCIDAGRADASVGEMSDAMEKVFGRYTAQIRTIEGVYSKAAGN
FT                   SESTKKVHELIKQFEEKEGRRPRIMIAKMGQDGHDRGQKVVATAYADLGMDVDVGPLFQ
FT                   TPEETARQAVEGDVHVVGVSSLAAGHLTLVPALRKELDKLGRSDIMIVVGGVIPTQDFD
FT                   ELRKDGAAAIYPPGTVIPDAAVELMEKLLAAHNDD"
     gtgaccaccc tgcctcgttt cgattccatt aacctcgggg attccccggt tcccgcagat        60
     gcgcaggagc agttcgccag attggctgcg gccgccggtg agcaggagcc ctggaccact       120
     ccggagcaaa ttccggttgg tcacctctac tccgaggacg tctacggtga catggactgg       180
     ctagacacct acgccggtct gccaccattc acacatggcc cgtacgctac catgtatgcc       240
     ttccgaccgt ggacgattcg ccagtacgcc ggattctcca ccgctaaaga gtccaacgcg       300
     ttctaccgtc gtaacctggc cgccggtcag aagggcctgt cggtcgcctt cgacctgccg       360
     acccaccgcg gctacgactc tgacaacccg cgtgttcccg gcgatgtcgg tatggcaggc       420
     gtggccgtgg actccatcct ggacatgcgt gagctctttg cgggcatccc gctggaccgc       480
     atgtcggtgt ccatgacgat gaacggcgca gtgctgccga ttcttgccct gtacgttgtt       540
     accgctgagg agcaaggcgc caagcccgag cagctcgccg gaacgatcca gaacgacatc       600
     ctcaaggagt tcatggttcg taacacctac atctacccgc cgctgccttc gatgcggatt       660
     atctccgaca tcttcgcgta caccagcgcg aacatgccga agtggaactc catctcgatc       720
     tccggctacc acatgcaaga agctggcgct accgccgata tcgagatggc ctacactctg       780
     gccgacggcg ttgattacat tcgcgccggt gagtcggtgg gcctacaggt cgaccagttt       840
     gcgccgcgtc tttccttctt ctgggccatt ggcaccaact tcttcatgga ggtcgccaag       900
     atgcgtgcgg cccgcatgct gtgggccaag ctggtgcacc agttcaaccc gaagaatccg       960
     aagtcgatga gcttacgcac tcactcgcag acctctggct ggtcgttgac agcccaggac      1020
     gtttacaaca acgtgattcg tacttgtgtg gaggccatgg gagccactca gggacacact      1080
     cagtccctgc acacgaactc cctcgacgag gccatcgctc tgccgaccga cttctccgcc      1140
     cgtattgctc gaaacaccca gctgttcatc cagcaggagt cgggcacctg ccgcgttatc      1200
     gatccttgga gcggctcggc ctacgtcgag aagctcaccc tcgagctggc tcgcaaggcc      1260
     tgggctcaca tccaggaggt cgagaaggcc ggtggtatgg ccaaggccat tgagaagggc      1320
     atcccgaaga tgcgcatcga ggaagctgct gctcgtaccc aggctcgtat cgactcgggt      1380
     cgtcagcccc tcatcggcgt caacaagtac cgtctcgacg aggaggagcc cctcgaggtc      1440
     ctcaaggtcg acaacactca ggtactcaag gaacagaagg ccaaactcga gcagctgcgc      1500
     gccaaccgcg acgaggaggc gtgccaggcc gctctggaga agatcacctg ggcagctgcc      1560
     aacccggatc cgagtgatcc tgaccgtaac ctgctcaagc tgtgcattga cgctggccgc      1620
     gcagatgcgt ctgtcggtga gatgtctgac gcaatggaga aggtcttcgg gcgttacact      1680
     gcccagatcc gtaccattga aggcgtgtac agcaaggcag ccggcaattc tgagtccact      1740
     aagaaggtcc acgagctcat caagcagttc gaggagaagg aaggccgtcg tccgcgtatc      1800
     atgatcgcga agatgggcca ggacggtcac gaccgtggcc agaaggtcgt cgcgaccgct      1860
     tatgctgacc ttggtatgga cgttgatgtc ggcccgctgt tccagacccc ggaggagact      1920
     gctcgacagg ctgttgaggg tgacgtccac gttgtcggtg tctcctcact ggccgccggg      1980
     caccttacgc tagtgccggc cctgcgtaag gaactggaca agcttggtcg ctccgacatc      2040
     atgattgtcg tcggtggcgt cattccgacc caggacttcg acgagctgcg caaggatggc      2100
     gcggcggcca tctatccgcc tggcaccgtt atcccggacg ctgccgttga gttgatggag      2160
     aagctgctcg ccgcgcacaa cgacgactga                                       2190
//

If you have problems or comments...

PBIL Back to PBIL home page