(data stored in ACNUC30630 zone)

EMBL: AE017283.PE597

AE017283.PE597       Location/Qualifiers
FT   CDS_pept        669695..670585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0606"
FT                   /product="putative transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0606"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82362"
FT                   /db_xref="GOA:Q6AA54"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AA54"
FT                   /protein_id="AAT82362.1"
FT                   /translation="MTTSTVFPASSALCVRKRSINKSKFHGWGLFRHYIALLVVFVVLV
FT                   SPVFLPLLGAFKSSGDPIYGKGATAFPQHWSLNAFGELFRTTDIVRYIANLFAVCGLNI
FT                   VSALVFSSVCGYMLSRKGWPGRGVVTAVALSALIFPFESIMLSLYSQVRSFGFYDTIIG
FT                   IWPPGMIGPFHVLLMRAAFLGIPDEIEDAAYIDGAGEVRRFFTIFLPQVKGSLVVGLTA
FT                   FIFAWQDYLWPLLITQSSSNYTMMIGIAQLQSSFGTDYRIVLAGAITAVIPIFLVFLAS
FT                   QRYFFRGIEEGGLKF"
     gtgaccacat ccactgtttt tcctgcgagt tcggcactgt gcgtgcgcaa acgctccatc        60
     aacaagtcca aattccatgg ttggggtctc ttcagacact acatcgccct actcgtggtc       120
     tttgtcgtcc tcgtgagccc ggtgtttctc ccactgctgg gagccttcaa gagctccgga       180
     gatccgatct acggaaaggg agccacggca ttcccgcagc actggtccct caacgcgttc       240
     ggtgagctgt tccgtactac tgacatcgtg aggtacatcg ccaacttgtt cgcggtgtgc       300
     ggcctcaaca tcgtctctgc cctggtcttc tcctcggtct gtggctacat gctctcccgc       360
     aagggatggc cgggtcgagg cgtggtgacg gccgttgccc tgtcagctct gatcttcccc       420
     tttgaatcga tcatgctgtc gttgtactcg caggtccgtt ccttcgggtt ctacgacacc       480
     atcatcggta tctggcctcc aggcatgatc ggacccttcc atgtgctcct catgcgggcc       540
     gcattcctcg gtatcccgga tgagatcgag gacgccgcct atatcgacgg tgcgggtgaa       600
     gtgcgaaggt tcttcaccat cttcctgcca caggtcaagg gatccctcgt cgtcggcctg       660
     acagccttca tcttcgcgtg gcaggactat ctgtggccgc tgctcatcac tcagtcctcc       720
     tcgaactaca cgatgatgat cggtatcgcg cagctgcagt cctcattcgg aacggactac       780
     cgaatcgtgc tcgctggcgc cattactgcc gtgatcccca tcttcttggt gttcttagcc       840
     tcccagcgct acttcttccg tggcatcgag gaaggcggac tgaagttctg a                891
//

If you have problems or comments...

PBIL Back to PBIL home page