(data stored in ACNUC30630 zone)

EMBL: AE017283.PE604

AE017283.PE604       Location/Qualifiers
FT   CDS_pept        675252..677426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0613"
FT                   /product="hypothetical protein, putative permease"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0613"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82369"
FT                   /db_xref="GOA:Q6AA47"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AA47"
FT                   /protein_id="AAT82369.1"
FT                   /translation="MKGVRLALRLSRGAGRHERVRSLVMIVGVALATLGLAVGVTLPRV
FT                   TAQQQEVRDARTPILAPDEPADGHTGFKVQELQVDGTPWTSFVVNHPADRLPPGLKHWP
FT                   QPGHTIVSPRLKSLMDAGVVNISSLGTIDPVVVDRAALASPDELFSITTTSDQAGCREL
FT                   KAFGLTRIGDSGVSSRTVWIEVIGLVALPAAVLLWTSLSLSAASRRDRFMTLVRMGCDP
FT                   DWCGQVFAVEVSGTAGLGALLGLALFIPVQNALGSSGTLGLTWWPWQARLRWPEWLIIV
FT                   VIMVIASGWLARRALRRLLASRRPPRRRARLGTVRHLLGIVGLLLVVAAIGLEGWICLT
FT                   MALAHDGQRLGDHAAGYIMGAAVFGTLGAVMSAHLIIVWCAGREQLRLPTRLGLTLARA
FT                   HYLDSAAMVIALTIMVGLAGFGSGFLVSGTHDTAGDPHHVLVQVPFTDRTATEQQALRR
FT                   VTRPRRMIYTATDGRTLVAASCADLAAFDPYPRSCPRTPATRRDASSTWTFGHDKHTTV
FT                   RTIKPVSRLPVTYDDDALLARNDPRLAGLTPDILEFTADSTTGDLDRLVDQLHGAAPSY
FT                   AAYAGAENPDTLQAFIQQQGIVRSGLAAGFLLILVACTAAFVELRWGMRRTIAVQQAVG
FT                   TPARILRRSFLMQMIVTILPAQTMSLVVGVLAGWAINAAIGSTDANQSFDPTIAALPVT
FT                   MWAVSVLAIMVTAFATGVPRFQLSAVRDTT"
     gtgaaaggtg tgcgtctggc gttgcgattg agccgtgggg cgggtcgtca tgagcgggtg        60
     cgatcgttgg tcatgattgt cggtgtggcc ttggccacac tcgggttagc ggtgggtgtc       120
     accctgcctc gcgtcaccgc tcagcagcag gaagtgcgtg acgcgcgtac ccccatcctt       180
     gctccggatg agcctgctga cgggcatacc ggtttcaagg tgcaggaatt acaggtcgac       240
     ggtacgccct ggacgagttt cgtggtgaac caccctgctg accgcctacc cccaggacta       300
     aagcactggc cccaacctgg tcacaccatc gtgtccccgc gtctgaagtc gttgatggac       360
     gccggggtcg tgaacatctc tagcttaggc acaatcgatc cggtggtggt ggatcgggcc       420
     gctttggctt cacccgatga actgttctcg attacgacca cctccgatca ggctggttgc       480
     cgcgagctga aggccttcgg cttgaccaga atcggtgatt ctggggtgtc gtcgcgtacc       540
     gtgtggatcg aggtgatcgg actggtggcg ctgccggcag ccgtgttgtt gtggacgtca       600
     ctgagcctat cggctgcctc gcgccgcgac aggttcatga cgttggtgcg catgggatgc       660
     gaccccgact ggtgtggcca ggtcttcgcc gtcgaggttt ctgggaccgc tggcctaggc       720
     gctctgctcg ggttggcact gttcattccc gttcaaaacg cccttggatc gagtgggacg       780
     ctcgggttaa cgtggtggcc ctggcaggcg aggctgagat ggcctgagtg gctcatcatc       840
     gtcgtcatca tggtgatcgc gagtggctgg ttggcccgtc gcgccctgcg aaggctgctg       900
     gcttcacgcc gccccccgcg ccgccgtgcc cggcttggga cagtgcgtca tctgctcggg       960
     atcgttggtc ttctcctcgt ggtggctgcg atcggtctgg agggctggat ctgcctgacg      1020
     atggcactcg cccacgacgg ccagcgcctg ggggaccacg ccgctggata catcatgggc      1080
     gcagcggtgt ttggaactct cggtgccgtc atgtcagccc acctcatcat cgtatggtgt      1140
     gccggccgtg aacagctgag actgcccacc cgtcttgggt tgaccctggc tcgggctcac      1200
     tatctagatt ccgctgcgat ggtgatcgca ttgacgatta tggtcggtct agctggattt      1260
     ggatcgggat tcctcgtttc tggcacccac gatactgcgg gggaccccca ccacgtcctc      1320
     gtccaggtcc ccttcaccga ccggaccgcc accgaacagc aagccctccg gcgcgtcacc      1380
     cggccccgac gtatgatcta cacggctacc gacggtcgta ccctcgtcgc ggcctcctgc      1440
     gctgacttgg ccgccttcga tccctatccg cgatcctgtc ccaggacgcc ggcaacgagg      1500
     cgagacgcgt catcgacatg gacctttggc cacgataaac acaccacggt ccgtaccatc      1560
     aagcccgtca gccgcctacc cgtcacctat gacgatgacg ccctcctcgc tcgcaacgat      1620
     ccgagactgg caggtctcac accagacatc ctggagttca ccgcagactc cacaactggc      1680
     gacctcgatc ggcttgtgga tcaactccac ggagctgcgc cgtcctatgc ggcctacgcc      1740
     ggggccgaaa atcccgacac tctacaggcg tttatccaac agcagggaat cgtgcgtagc      1800
     ggcctggcgg ccggattcct gctgatcctg gtggcatgta ctgcagcttt tgtcgaattg      1860
     cgctggggaa tgcggcgtac cattgccgtt caacaagccg tgggtactcc cgcccgtatc      1920
     ctgcgaagat ccttcttgat gcagatgatc gtcacgattc tgccagccca gacgatgtca      1980
     ctggtggttg gagttctggc tggctgggcg atcaatgccg cgatcggatc gaccgacgcg      2040
     aatcaatcct tcgaccccac cattgcggcg ctacccgtca ctatgtgggc ggtcagtgtg      2100
     cttgccatta tggtcactgc gtttgcgact ggtgtgcctc gttttcagct atcggctgtg      2160
     agggatacca cgtag                                                       2175
//

If you have problems or comments...

PBIL Back to PBIL home page