(data stored in ACNUC30630 zone)

EMBL: AE017283.PE616

AE017283.PE616       Location/Qualifiers
FT   CDS_pept        690354..692018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0625"
FT                   /product="NAD(P) transhydrogenase subunit alpha"
FT                   /EC_number="1.6.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0625"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82381"
FT                   /db_xref="GOA:Q6AA35"
FT                   /db_xref="InterPro:IPR007698"
FT                   /db_xref="InterPro:IPR007886"
FT                   /db_xref="InterPro:IPR008142"
FT                   /db_xref="InterPro:IPR024605"
FT                   /db_xref="InterPro:IPR026255"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AA35"
FT                   /protein_id="AAT82381.1"
FT                   /translation="MRWVTASGVRHFSLHIAPNLGKRATPVSWVRTFGRKVTIMIIGIP
FT                   RELLPGENRVAATPTTVPALLKLGYEVVVEAGAGEHAAQPDRAYEEAGARIVEPGEAWK
FT                   ADLVLAVNEPTDDQISLMRAGAVLVTFLHPRQDLALTEKLAAAGVTGLSMDMVPRISRA
FT                   QSMDALSSMANISGYRAVVEAAFAYGRTFGGQVTAAGKVPPAKVFVIGTGVAGLAALGA
FT                   ANSMGAEVYATDVRPETAEQVQSMGAIFLHVRTGDSDQGVSSDGYAKETSDDYNARAAE
FT                   LYMEQAGKDDVIITTAAIPGKPSPKLITAEMVYAMKPGSVIVDLAALGGGNCELTRPGE
FT                   SYVTDNGVTIIGYTDLPSRLPGQASQLYGTNLVNLLKLATPEKNGELVLNFDDEVIRTM
FT                   TVCHEGQVAFPPPPVQVAAAPKPVAKAEIASAPATPEKKPRPWPQTFGIVAVLSIALIA
FT                   LLTFSPMEFVALFGTFAIAVVVGYYVVWNVTHALHTPLMSVTNAISGIIIVGAITQLGS
FT                   ESWGIRIVAALTVLIASINIFGGFTVTQRMLKMFRKA"
     atgcggtggg ttactgcaag tggggtgcgc catttttcac tccacatagc ccccaatctg        60
     gggaaacgtg caaccccggt gtcgtgggta aggacgtttg gccgtaaagt caccatcatg       120
     atcatcggaa tcccacggga gttactccca ggtgagaatc gggtcgccgc gactccgacg       180
     actgttcccg ccctactcaa actcggctac gaggtggtcg tcgaggccgg agctggcgag       240
     catgctgctc agcctgaccg cgcgtatgaa gaggccggag caaggattgt cgaaccgggg       300
     gaggcgtgga aggctgacct cgtactggcc gtcaacgaac ccaccgacga ccagatctcc       360
     ctcatgcgcg caggagccgt cctcgtcacc tttctccatc cccgtcagga cctcgccctt       420
     accgagaagc tggccgcagc tggcgtcacc ggtctcagca tggatatggt cccgcgcatt       480
     tcgcgcgccc agtcgatgga cgcactgtct tcgatggcca atatctccgg ttaccgcgcc       540
     gtcgtcgagg cggcattcgc ctacggacgc accttcggtg gccaggtcac tgcggcaggc       600
     aaggttccgc cggccaaagt cttcgtcatc ggtactggcg tcgccggttt ggctgcactg       660
     ggcgccgcca attcgatggg tgccgaggtt tacgccaccg atgtccgccc cgagaccgct       720
     gagcaggtgc agtcgatggg cgccatcttc ctacacgtgc gaaccggaga ttctgaccaa       780
     ggcgtcagtt ctgacggcta cgccaaagag acgagcgacg actacaacgc ccgcgccgcc       840
     gagttgtaca tggaacaggc tggcaaggac gatgtcatca tcaccacggc tgctatccct       900
     ggcaagccgt cccccaaact catcactgcc gagatggtct acgcgatgaa gcctggcagc       960
     gtcatcgttg accttgctgc cctagggggt ggcaactgcg agttgactcg ccccggtgag      1020
     tcctatgtca ccgataacgg tgtgacgatt attggttaca ctgatctgcc gtctcgcctg      1080
     cctggtcagg ccagccagct ttacggcacc aacctcgtca atttgcttaa actggccacc      1140
     ccggaaaaga acggcgagct cgtccttaac tttgacgacg aggtcatccg cactatgacg      1200
     gtgtgccacg aaggtcaggt ggctttccct ccacctccgg tacaggtcgc tgccgcgccc      1260
     aagcctgtcg ccaaagccga gattgccagt gctccggcca ccccggagaa aaagccgcgc      1320
     ccgtggccgc agaccttcgg catcgtcgca gtgctgtcga tcgcgctgat tgccctgttg      1380
     accttctccc cgatggaatt cgtagccttg tttggcacct tcgccatcgc ggtcgtcgtt      1440
     ggctactacg tggtgtggaa cgtcacccac gcactccaca ccccgcttat gagtgtcacg      1500
     aacgctatca gcggcatcat catcgttggt gcgatcaccc aactcggcag tgaatcgtgg      1560
     ggtatccgga ttgtcgccgc gttgactgtg cttattgcca gtatcaacat ctttggcggc      1620
     ttcacggtca cccagcgcat gctcaagatg ttcaggaagg cctga                      1665
//

If you have problems or comments...

PBIL Back to PBIL home page