(data stored in ACNUC30630 zone)

EMBL: AE017283.PE63

AE017283.PE63        Location/Qualifiers
FT   CDS_pept        complement(70321..71691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0068"
FT                   /product="putative two component sensor kinase"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0068"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81828"
FT                   /db_xref="GOA:Q6ABN7"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABN7"
FT                   /protein_id="AAT81828.1"
FT                   /translation="MEDTGSQTLPTENRSTGSRGAGVRARLNRFNPSRNNVPQINIPGM
FT                   EEVLDPKLDDGRPADTERAWWGDVTLTLIMAVVTIAPYLVSLVEWPRPEYIAALLSSMV
FT                   MVASLPMRREHPLLMMTLVAIGAAIQFFFVPFPVLSIFVVPIASYSVARWVDGHQSRWV
FT                   LWVGAVGSVIGPMRWIPTIAAGYDPSSGTPWVLLVLAMTVCAGLVLTPYAVGRRLRESA
FT                   LIDSQQRIVKAQRYRAILAEREQQARVAEERTRNEIARELHDIVAHSLSVMIVQAEGGK
FT                   ALATKKPEKAPEVLETIAETGREALLEMRRIVGVLRQDTDAEFSPSPSLAEIPDLVDKS
FT                   GVKVELKVTGEEPVVSQALGLVIYRVVQEALTNVLKHAGPSAHATVTLAYSPTAIYVEI
FT                   LDDGYGAAVQGDGRGHGLQGMRERVTSMGGQLSAGPRKEGGFRVMAKLPVQADSRQR"
     atggaggaca ccggatcgca gaccttgccc acggagaacc gttccaccgg ctcccgcggg        60
     gcgggggtac gcgcccgtct caatcggttc aatccgagcc gcaataacgt tccccaaatc       120
     aacatccccg gtatggagga ggtgctggac cccaagctcg atgacggccg cccggctgac       180
     accgaacggg catggtgggg agacgtcacc ctgaccctca tcatggccgt agtgacgatc       240
     gccccctacc tcgtcagtct ggtggagtgg ccgcgcccgg agtacatcgc cgccctcttg       300
     tcatcgatgg tcatggtggc ctctctgccg atgcgtcgcg agcatcctct tctcatgatg       360
     accttggtcg ctatcggggc tgcgatccag ttcttcttcg tgcctttccc ggtgttgagc       420
     atcttcgtcg tcccgatcgc ctcctactcg gtggcgaggt gggtcgacgg ccaccaatcc       480
     cgctgggtgc tgtgggtggg agccgtgggg tcagtcattg gaccgatgag gtggatcccc       540
     accattgccg ccggttacga tccctcatcg ggaacgccct gggtgctact ggtgctggcc       600
     atgacggtgt gtgcgggcct cgtcctcacc ccatacgcgg taggtcgacg actgcgggag       660
     tccgccctca tcgactccca gcaacgcatc gtcaaagccc agcggtaccg ggcgatcctc       720
     gccgaacgtg aacagcaggc cagggtggcc gaggagcgca cccgtaacga gatcgccaga       780
     gagctccacg acatcgtcgc ccactcgctg tcggtcatga ttgtgcaggc cgaaggcggc       840
     aaagcactgg cgacgaagaa gccggagaag gcccccgagg tgcttgagac gatcgccgag       900
     accggacgtg aggccctcct tgaaatgagg cgaatcgtcg gggtgttgcg tcaggacacc       960
     gacgccgagt tctccccctc ccctagcctg gctgaaattc ccgacctggt ggacaagtcc      1020
     ggggtgaaag ttgaactcaa ggtgactggg gaggagccgg tggtctccca ggctcttggg      1080
     cttgtgatct accgagtcgt tcaggaggcc ctcaccaacg tcctcaaaca cgctggcccg      1140
     agcgcccacg ccactgtgac cctggcctat tcacctaccg cgatctacgt ggagattctc      1200
     gacgacgggt acggggctgc cgtccaaggg gacggtcggg gacacggtct ccaggggatg      1260
     cgagagcgcg ttacgtcaat gggtgggcaa ttgtcggcgg ggcctcgcaa agagggcggg      1320
     ttccgcgtca tggcgaaact gccggtccaa gccgactccc gtcagagatg a               1371
//

If you have problems or comments...

PBIL Back to PBIL home page