(data stored in ACNUC30630 zone)

EMBL: AE017283.PE648

AE017283.PE648       Location/Qualifiers
FT   CDS_pept        721409..722443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0657"
FT                   /product="iron transport system, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0657"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82413"
FT                   /db_xref="GOA:Q6AA03"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:Q6AA03"
FT                   /protein_id="AAT82413.1"
FT                   /translation="MSRWRSWLLLGIVVAALIGSALVVLGIGAVRVPVSDVARVVARRF
FT                   RLIEGADVTVLNDQIVWQMRAPRVIGSMAVGALLAMCGAVLQTLTGNDLADPYLLGISS
FT                   GASVGAVFVLIVGISSTLGQSVLMTLASFIGAVVALVMVLTMATGRSGELPAGRTILAG
FT                   VAVGQLCGAAVSVMIMIFGESNAARSALSWTLGSFAGLRWGSTITLVVATVPALVVGMA
FT                   LCHILDAFAFGDISAMSLGVPVNTVRWAIMVSTALLTALSVAFAGPIGFVGLTVPHIVR
FT                   FWTGSRHARLLPISALAGALLMVWSDTAARCLRPDTEIPVGVITAIVGAPVLVVLLRRQ
FT                   ASRS"
     gtgagccgct ggcgcagttg gctcctgctc ggcattgtcg ttgctgccct gatcggcagt        60
     gccctcgtag tcctggggat cggggcagtt cgggttccgg tttccgatgt ggcgcgggtg       120
     gtggcgcgac gctttcggct cattgaagga gccgacgtga cggtcctcaa cgaccagatc       180
     gtatggcaaa tgagggcccc gcgtgtcatc ggatcgatgg ccgtcggtgc tttgttggcg       240
     atgtgcggcg cggtgttgca gaccttgacc ggcaacgatc tggctgatcc gtacctacta       300
     ggtatctcca gcggggcgtc ggtcggggcg gtcttcgtcc tgatcgtcgg gatttccagc       360
     accctcgggc agtcggtcct tatgaccctg gcctccttca ttggagccgt cgtagccttg       420
     gtcatggtgc tgacgatggc cacgggcaga tcaggggaat tgcctgccgg ccgaacaatc       480
     ttggccggtg tggccgtggg ccagttgtgc ggagcagcgg tgtcggtgat gatcatgatc       540
     ttcggggagt cgaatgcggc ccgttcagct ctgtcatgga cccttgggtc cttcgccggg       600
     ctgaggtggg gatcgacgat cacgctggtt gttgccaccg tgccggcgct ggtcgtcggg       660
     atggctttgt gccacatcct tgacgccttc gcatttggag acatcagtgc gatgtcgttg       720
     ggtgttccgg tgaacactgt ccgctgggca atcatggtca gcacggctct gctgacggcc       780
     ctcagcgtgg cgttcgctgg acccatcggc ttcgtcgggc tcacggttcc ccatatcgtg       840
     agattctgga ctgggtcgcg tcacgctcgt cttctgccga tatctgccct ggccggagcg       900
     ctgctcatgg tgtggtcaga caccgctgca cgatgtttac gtcccgatac cgaaatcccc       960
     gtgggcgtca tcaccgcgat cgtcggggcc ccggtgctag tcgtgctttt gcgtcgacag      1020
     gcctcgagat catga                                                       1035
//

If you have problems or comments...

PBIL Back to PBIL home page