(data stored in ACNUC30630 zone)

EMBL: AE017283.PE671

AE017283.PE671       Location/Qualifiers
FT   CDS_pept        745628..746395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0680"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0680"
FT                   /db_xref="EnsemblGenomes-Tr:AAT82436"
FT                   /db_xref="GOA:Q6A9Y0"
FT                   /db_xref="InterPro:IPR009898"
FT                   /db_xref="UniProtKB/TrEMBL:Q6A9Y0"
FT                   /protein_id="AAT82436.1"
FT                   /translation="MLRRVTRSSWETHSSPGIRPGSLRVAAVRSARSSSSTLPAEGSVT
FT                   PLLPGSGLPAAINCSSGWTFLSRMPMSVPSTTDRARRHPEVAALVGVVAGIFSAIVKFG
FT                   WEVPFPPRTPERNATNPPQQLLEQLGFSDHFAHTLVYFNGNGLPVMSFIIHFGFAIFFG
FT                   VAYCVGAERFPKITLWQGVAFGVVVYVVFHVIVMPGLGTVPAPWHQPWQEHLSELLGHI
FT                   VWMWSIEVVRRDLRSRITGEPDPWVEPSMTAGR"
     atgctgagga gggtcacgag gtcgtcgtgg gagacccact catcacctgg aatccggccg        60
     gggtcgttgc gggtggccgc agtgcggtct gcccgatcgt cgtcctcgac gcttccagcg       120
     gaaggatcgg tgacgccgct gttaccgggg agcggattgc ctgcggcgat caattgttcc       180
     agtggttgga cgttcctgag caggatgcca atgtctgtgc ccagcacgac tgatcgggcc       240
     cgtcgtcacc ctgaggtagc ggctctggta ggggttgtcg ccggaatttt ctcggcgatc       300
     gtcaagtttg ggtgggaagt gcctttccca ccgcgcaccc ctgagcgaaa cgcaacgaat       360
     ccgccccagc aattgttgga gcagctggga ttcagcgatc actttgccca cacgctggtg       420
     tatttcaacg gcaatggctt gccggttatg agcttcatca ttcacttcgg atttgccatc       480
     ttcttcggcg tcgcgtattg cgttggcgct gaacggttcc cgaaaatcac actatggcag       540
     ggcgttgcgt ttggtgtcgt cgtctacgtc gtctttcacg tcatcgtgat gccgggattg       600
     ggtaccgttc cggcgccgtg gcaccagccg tggcaggaac atctcagtga gttgttgggt       660
     cacatcgtct ggatgtggag catcgaggtc gtgcgccgtg acctgcgtag ccgcatcact       720
     ggcgagcccg atccgtgggt tgagccatcg atgacagcag gacgataa                    768
//

If you have problems or comments...

PBIL Back to PBIL home page