(data stored in ACNUC30630 zone)

EMBL: AE017283.PE7

AE017283.PE7         Location/Qualifiers
FT   CDS_pept        9733..11805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0009"
FT                   /product="DNA gyrase subunit B"
FT                   /EC_number="5.99.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0009"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81772"
FT                   /db_xref="GOA:Q6ABQ6"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABQ6"
FT                   /protein_id="AAT81772.1"
FT                   /translation="MSQPEMPESVTDGDTPEDLLIDATDHPDGLDSELPPTAVDGSYDA
FT                   GQITVLEGLEAVRKRPGMYIGSTGERGLHHCVYEIVDNSVDEAMAGYCDTIQVELLDDN
FT                   WCQVTDNGRGIPVKEHPVEHIPTVTLVLTKLHAGGKFGNGGYKVSGGLHGVGSSVVNAL
FT                   AAHFIVEVRRDGYHWRQSFSLGEPDGPLEQLEALGPDDYEGTTVRFQPSDEIFDAIVFD
FT                   YQTLSNRFREMAFLNKGLRIVLTDRRADHADEDGNPVHEDFLYKEGLKDYVRFLTGTRD
FT                   VINPTIISLESHRPEEGMGLEIAMQWNTSYATSVHTFANAINTIEGGAHEEGFRAALTN
FT                   TVNRWGETWGLIKKREDRVSGDDIREGLTAVVSIKLTEPQFEGQTKTKLGNAEAKSFVQ
FT                   KALNEKLSDWFEENPNEGKSIVRKSQAAAQARVAARKARDLARNRKGLLGSTSLPGKLK
FT                   DCSSTSPEECEIFIVEGDSAGGSASQGRDPRIQAILPLRGKILNVEKARLDRALGSETI
FT                   ESIINALGTGVHEDFDLDKLRYHKIILMADADVDGAHIRTLLLTLLFRFMRPVIDAGHV
FT                   YLAQPPLFRLRWTNSPHELAYSDEERDLLREDGLTHGKKLPQVNPIQRYKGLGEMDAED
FT                   LWDTTMDPDKRLLLQVTLEDAALADQMFSILMGEDVEQRRSFIQRNAKDVRFLDI"
     gtgagccagc ccgagatgcc cgagtccgtg accgacgggg acacccccga ggaccttctc        60
     attgatgcta ccgatcatcc tgatggtctg gactcagagc ttcccccgac ggccgtcgac       120
     ggttcctacg atgccggtca aatcaccgtc ttagaaggct tggaggccgt tcgtaagcgt       180
     cccggcatgt atatcggctc tactggggag cgcgggttgc atcactgcgt ctatgagatt       240
     gtcgataact ccgtcgacga ggcgatggcc ggttattgcg acaccatcca ggttgagtta       300
     ctcgacgata actggtgcca ggttaccgat aacgggcgag ggattcccgt caaggagcac       360
     cccgtcgaac acatccctac cgtcactttg gtactgacca agctgcacgc cggcggtaag       420
     ttcggcaacg gcggttacaa ggtctccggt ggtctacacg gcgtcggctc ctcggttgtt       480
     aatgctctag cggcccactt catcgtcgag gtccgacgag acggctacca ctggcgtcag       540
     tccttcagcc tcggtgagcc tgacggtccg ctggagcagc ttgaggcact cggccccgac       600
     gattacgaag gcaccacggt gcgtttccag ccctccgacg agatcttcga tgccatcgtt       660
     ttcgactacc aaaccttgtc gaaccgtttc cgtgaaatgg ccttccttaa taagggtctg       720
     cgtatcgtgc tcaccgaccg ccgtgccgac cacgctgatg aggacggcaa cccggttcac       780
     gaggacttcc tctataagga ggggcttaag gactacgtcc gattcctcac ggggacccgc       840
     gacgtcatca accccaccat catctccttg gagtcccacc gtcccgagga gggtatgggt       900
     ttggagattg cgatgcaatg gaacacctcg tacgccacca gcgtccacac tttcgccaac       960
     gccatcaaca ccatcgaggg cggagctcac gaggaaggct tccgtgccgc tctcaccaac      1020
     accgttaatc ggtggggtga gacttgggga ctcatcaaga agcgtgagga tcgcgtttcc      1080
     ggtgacgaca tccgcgaggg cctgacagcc gtcgtctcca tcaagctcac cgagccgcag      1140
     ttcgagggcc agacaaagac caaactcggc aacgccgagg ccaaatcttt cgtccaaaaa      1200
     gcccttaatg agaagctctc ggactggttc gaggagaatc ccaatgaggg caagagcatc      1260
     gtccgaaagt cacaagccgc tgcccaggct cgcgtagccg ctcgcaaggc ccgcgatctg      1320
     gcccgtaacc ggaaaggcct gctggggtcg acgtcactgc ccggcaaact caaggactgc      1380
     tcctcaacca gcccggaaga gtgcgagatc ttcattgtgg agggcgactc cgctggtggt      1440
     tcggcctctc agggccgtga tccacgtatt caggcgatcc tgccgttgcg aggaaagatc      1500
     ctcaatgttg aaaaagcccg cctcgaccgc gcgttgggtt cggaaactat tgagtcgatc      1560
     attaacgcgt taggaaccgg cgtccacgag gacttcgatc tggacaaact gcgttaccac      1620
     aagatcatcc tcatggcgga cgccgacgtt gacggcgctc atatccgcac cctgctactg      1680
     accctgctgt tccggttcat gcgtccggtc attgacgctg gccacgtcta cctggcacag      1740
     cccccgctgt tccgactgcg gtggacgaac tccccgcacg agctcgccta ctccgacgaa      1800
     gagcgcgacc tgctgcgcga agacggtctg acccacggca agaagctgcc ccaagttaac      1860
     ccgatccagc ggtacaaagg tctgggcgag atggacgccg aagacctgtg ggacaccacc      1920
     atggaccccg acaagcgtct gctgctccag gtgacccttg aagacgccgc gctggccgac      1980
     cagatgttct ccatcctcat gggtgaggac gtcgaacagc gccgatcgtt cattcagcgc      2040
     aatgccaagg acgtccgctt cctcgacatc tga                                   2073
//

If you have problems or comments...

PBIL Back to PBIL home page