(data stored in ACNUC30630 zone)

EMBL: AE017283.PE75

AE017283.PE75        Location/Qualifiers
FT   CDS_pept        86995..88281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0080"
FT                   /product="chloride channel protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0080"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81840"
FT                   /db_xref="GOA:Q6ABP4"
FT                   /db_xref="InterPro:IPR001807"
FT                   /db_xref="InterPro:IPR014743"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABP4"
FT                   /protein_id="AAT81840.1"
FT                   /translation="MVTSRIRFVAAVVLTGLASGLIGGLTSELSHLIEVCAFGVPFSSS
FT                   TTGVGEVVMWRRLVAPIMGALIAGLTWRWLRPFPSGSITSVRQAIDSPTRLRPVETIVD
FT                   ALAQLVVVGSGSSLGREAAPRQMAALAAQGLSDTFRVDVATRRVVLASAAGAGLASVYN
FT                   VPVAGALYALELTVRPDLRTKRGWGQVGIAGVISVLSTVTAWLLNHDRPIYRSPAATVT
FT                   GPGLGWMVLVVAVSTVVGAGMGVLFGEMKRRVPVTSRLWWTVPLGSAGVTAIALAAPQV
FT                   VGNGQVIVNLVLAHPVAPASLVILLVGKILATTVALRSGAAGGLLTPSLSAGALVGALV
FT                   AVVAGIDAPSQIAMMVIVGAGCVLSMTQRAPLFAAAFALELTRAGALGIPVVVAAVMLG
FT                   WTGFVLVSRRGLGLHGRIGRAPGHTSDPR"
     gtggtcacct cacggatccg attcgttgcc gccgtcgtac tgacggggtt ggcgtcggga        60
     ctcatcggtg gccttacaag cgaactgtcc cacctcattg aggtctgcgc cttcggtgtg       120
     cccttctcct cgtcgacgac gggtgttggg gaagtcgtta tgtggcgacg cctcgtcgcg       180
     ccgattatgg gtgctctcat tgcgggcttg acgtggcggt ggctgcgtcc gttcccatcg       240
     gggtcgatta cctcggtgcg acaggccatc gactctccga cgcggctacg cccagtcgag       300
     accatcgttg acgccctcgc ccagctcgtc gtcgtcgggt caggaagctc cctaggccga       360
     gaggcggcac cgcgtcagat ggctgccctg gctgcccaag ggctatccga cactttccga       420
     gtcgacgtcg ccacccggcg ggttgtgctg gccagcgccg ccggtgccgg cctggcatcg       480
     gtctataacg tgcccgtcgc tggagcgctg tacgccctag aactgacggt gcgccctgat       540
     cttcgcacca aacgtggctg gggacaggtg ggaatagccg gcgtcatctc cgtcctatca       600
     acggtgacgg catggttgtt gaaccatgac cgccccatct atcgttcacc agccgccaca       660
     gtgacaggtc ccggccttgg ctggatggtt cttgtcgttg cggtttccac cgttgtagga       720
     gccgggatgg gagtgctctt tggggagatg aaacggcgag tcccggttac ctccaggctg       780
     tggtggacgg ttccgttggg atcggccgga gtgaccgcca tcgctctggc ggcacctcaa       840
     gtggtcggaa atggccaggt catcgtcaat ctggtgctgg cccatcctgt ggctccagct       900
     agtttggtga tcctgctcgt cggcaagatt ctcgccacga cggtggcatt acgctccggt       960
     gctgccggcg gtctactcac cccgtcccta tccgcaggcg ccctggtcgg agctctggta      1020
     gccgtggtgg cagggatcga cgcaccctcc cagatcgcca tgatggtgat cgtcggtgct      1080
     ggatgcgtgt tgtctatgac ccagcgtgcc ccgctcttcg ccgccgcctt cgcgctagaa      1140
     ctgactcgtg ctggagcgct agggatcccg gtcgttgtcg cagcggtgat gctcggttgg      1200
     acagggttcg ttctcgttag taggcgtggt ctgggactcc acggacggat tggtcgggct      1260
     ccgggccata cgtctgatcc gcggtag                                          1287
//

If you have problems or comments...

PBIL Back to PBIL home page