(data stored in ACNUC30630 zone)

EMBL: AE017283.PE86

AE017283.PE86        Location/Qualifiers
FT   CDS_pept        complement(104055..104636)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0091"
FT                   /product="putative regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0091"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81851"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR025159"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABN1"
FT                   /protein_id="AAT81851.1"
FT                   /translation="MSTRHDDTASLVDPGSQKRIDEVADALRRRGGSATSAELASDLGI
FT                   HPSTARFHLDRLVEQGRVEATRRHRATRGRPHTVFTLVSDEGPRAYRLLAQMLVDEVAI
FT                   SNNPTAMAMRIGQRWGRHRRGDLIAVLDDMGFSPAAEEGGIVLRHCPFLDLARDHPQVV
FT                   CSLHCGVVEGVTGQAATIDANPGVRCVIHT"
     atgagcactc ggcacgatga caccgcgagc ctggtcgatc cggggtcaca gaagcgtatc        60
     gacgaggtcg ccgacgccct gagacgacgt ggcggttcag cgacgagcgc cgaactggcc       120
     tccgacctgg ggattcatcc ctcgacggcg cgatttcacc tcgaccgtct cgtcgagcag       180
     ggacgagtgg aggcaacacg tcgacatcgg gcgacccggg ggcgcccgca caccgtcttt       240
     accctcgtca gcgatgaagg gccgcgggcc tatcggttgc tagctcagat gctcgtcgac       300
     gaggtcgcca tcagtaacaa cccgacagct atggccatgc gcattggtca gcgttggggt       360
     cggcatcgcc gcggcgacct catcgcagtg ctcgatgaca tgggcttctc cccggccgca       420
     gaagagggcg gcatcgtgct gcgccactgt ccctttctcg acctggcccg cgatcacccc       480
     caggtggtgt gttccctaca ctgtggggtc gtcgagggtg tgacggggca agccgcgact       540
     atcgacgcta accccggagt ccggtgtgtg atacacacct ga                          582
//

If you have problems or comments...

PBIL Back to PBIL home page