(data stored in ACNUC30630 zone)

EMBL: AE017283.PE9

AE017283.PE9         Location/Qualifiers
FT   CDS_pept        14515..15147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0011"
FT                   /product="hypothetical conserved protein"
FT                   /note="membrane spanning"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0011"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81774"
FT                   /db_xref="GOA:Q6ABQ4"
FT                   /db_xref="InterPro:IPR021949"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABQ4"
FT                   /protein_id="AAT81774.1"
FT                   /translation="MSDEKKVTHPGPDDPEAIHWTAGDARRTFHEKGEERPDPRQESDR
FT                   KRTTASTPLRRTDSRGAQGEKAPNQQEPHRSPQAHQPARAPRRTRKARLRLTRVDPWSV
FT                   MKTSLLFGVAGAVIFFIATWIIWGIIGASGAFDSMNKVVNDLISSPSSTSKFELSDYVN
FT                   TGRVLGLTALIGAINAVLFTAISTLFSFLYNLAAQIMGGLEVTLAED"
     gtgagtgacg agaagaaggt gacgcatccc ggtcccgacg acccggaggc aatccactgg        60
     accgccggtg atgcccgccg taccttccac gagaagggcg aggagcgccc tgatccgcgt       120
     caggagtctg atcgcaaacg gacgacggcg tctaccccgt tgaggcgtac tgattcgcgt       180
     ggcgcccagg gggagaaagc cccgaaccag caggagccgc atcgttcgcc tcaggcgcat       240
     cagccggcac gcgctccgag gcgcacacgt aaggctcggt tgcgcttgac tcgcgtcgat       300
     ccgtggtcgg tcatgaagac ctctctatta ttcggtgtgg ctggcgcggt gattttcttt       360
     atcgcgacct ggatcatttg gggcatcatc ggtgcttcgg gtgcctttga ttccatgaat       420
     aaggtcgtca acgacctcat cagttcaccg agttcgacgt cgaagtttga gctgtctgac       480
     tacgtcaata ctgggcgtgt attgggtttg actgccctta tcggcgccat taatgcggtg       540
     ttgtttacgg cgatctcgac cttgtttagc ttcctctaca acttggctgc ccagattatg       600
     ggtggcttgg aggtcactct cgccgaagac tga                                    633
//

If you have problems or comments...

PBIL Back to PBIL home page