(data stored in ACNUC30630 zone)

EMBL: AE017283.PE95

AE017283.PE95        Location/Qualifiers
FT   CDS_pept        complement(117221..118207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0100"
FT                   /product="magnesium-chelatase subunit ChlI"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0100"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81860"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041628"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABM2"
FT                   /protein_id="AAT81860.1"
FT                   /translation="MAQRPVYPFCAIVGQEEMKLALILATISPDLSGVLIRGEKGTAKS
FT                   TAVRGLAALLPQHREIPGPYHLSPDEYPTHAVALNLPEVMPEPRTVQVPVVELPVGATE
FT                   DRVTGTLDMETALREGRRRFEPGLLAAAHRAILYVDEVNLLDDHVVDLLLDSAAMGVNT
FT                   VEREGVSVTHPARFTLVGTMNPEEGELRPQLLDRFGLCVTVSGEDDPDKRTEVIRRRMA
FT                   FEDDPGGFSRTWEQDGHKLSERIQRATELVTQVVISDETLTTAARTCINAHVDGHRADI
FT                   MMVRAARTLAAWNGCTEITTEDLSQAARLVLPHRMRRQPLESVGRAV"
     atggcacaac gccccgtcta tcccttctgc gccatcgtcg gtcaggagga gatgaagctg        60
     gctctcatcc tcgctaccat cagccccgat ttgtccgggg tacttatccg cggcgagaaa       120
     ggcaccgcca agtccaccgc ggtgcgcgga ctagcagccc tactgccgca acaccgggag       180
     attcccgggc cctaccacct gtcccccgac gagtacccga cccacgcggt cgcactcaac       240
     ctgcctgagg tcatgcccga gcctcgcacc gtgcaggtgc cggtcgtcga gctgccggtg       300
     ggagccactg aggatcgcgt caccggcact ctcgacatgg agacagccct gcgggagggg       360
     cgacgccgtt tcgagccggg tctgctagca gccgcgcacc gggcgatcct ctacgtcgac       420
     gaggtcaacc tcctcgacga ccacgtcgtt gacctgctgc tggactcagc cgccatgggc       480
     gtcaacaccg tagagcgaga gggggtcagc gtcacccatc cagcccggtt caccctggtc       540
     ggcaccatga atccggagga gggcgaactg cgcccccagt tgctcgaccg cttcgggctg       600
     tgcgtcaccg tcagcgggga ggacgacccg gacaagcgca ccgaggtaat ccggcgccga       660
     atggcctttg aggacgaccc tggtggcttc tcacgcacat gggaacagga tggccacaag       720
     ctcagcgaac ggatccaacg tgctactgag ctcgtcaccc aggtagtcat ctccgacgaa       780
     actctcacga cggcggctcg tacctgcatc aacgcacacg tcgacggtca ccgcgccgac       840
     atcatgatgg tccgggcggc gcgcactctg gcagcctgga acggttgcac cgagatcacc       900
     acagaggacc tctctcaagc tgcccggctc gtcctgccgc accggatgag acgacaacca       960
     ctcgagtcag ttggtagggc agtgtga                                           987
//

If you have problems or comments...

PBIL Back to PBIL home page