(data stored in ACNUC30630 zone)

EMBL: AE017283.PE97

AE017283.PE97        Location/Qualifiers
FT   CDS_pept        complement(120173..124195)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0102"
FT                   /product="cobalamin biosynthesis protein CobN"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0102"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81862"
FT                   /db_xref="GOA:Q6ABR7"
FT                   /db_xref="InterPro:IPR003672"
FT                   /db_xref="InterPro:IPR011953"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABR7"
FT                   /protein_id="AAT81862.1"
FT                   /translation="MPRRLPIPSRGQCPCRPGTAPDSPHLPHRQHSRPSGKCIMTTLSF
FT                   FSATGGELTLVSQALSRLRTRGLDITLFGRTKDQITDPELARAFAQAAARSDAIVLSFH
FT                   GGTTSCPAWPALVEAWKNRRESGLPLPWIHIQPTSGDDDGLLAAQDWASGLDDGTWRGL
FT                   IGLLEMGGPDNVEAALRILVDRVRGGSAPIPDVIPAPTEGIWHPRHGLFTNLAEYRHHL
FT                   DPDLPTVGITFPRSYWLEHNTAHIEALIEAIKGLDANTVPFFCLRLPDARRGNPSMAQT
FT                   LETLLRDDDGNRVIDTLIDVHGMSMTAGVPANADAYPKLGVSVLHALTSYAPLAAWKAQ
FT                   GMGAMDVATQAAQPEFDGALITKFLATREVDRVDDLTGAVVPHMVPVPGRPEAMAELAL
FT                   SWARLARTSANQRKVAIVFHHHPPRNDRIGCATGLDTFESVHRLLVRMAEDGYDVPEQF
FT                   DSADDLAQVLLSSLTCDQRWLTPEQMYQRAEVHADLATSRSWYRALPASVRESMDRAWG
FT                   PHPGSLFVHHDEFSFAGHLDGNVLLTIQPPRGNFEAVTDSDIHDPLLPPPHHYLAHYRW
FT                   IRDVFKADAVIHVGTHGSLEWLPGKGLGLSEECYPELALDRMVNIYPYIINNPGEGTQA
FT                   KRRSAAALIDHLTPPMRQAELYDSTAEIDRILREYAGAQSQSPQRARLVAEQVWDAVTK
FT                   AGLDTDLGLTSADVDADPVEVLDRVHHHLLDLQDREISDGLHVLGQVVAGHDDPIAAKV
FT                   EYVAQLTRQPNGPVPSLREAVLNAWGTSLDEVSARAGEPVPVTADLPDGLTGRQLMSEA
FT                   HRRCVKLLTPVVVRHRDRHPDDTEAHDLAAQLCHEQLGAERGDVIETLTWVLTDLMPRL
FT                   DATNNEIDAIMTALDGGFVAPGPSGAPSRGNAHILPSGRNFFSLDPQTMPTPTGWREGV
FT                   ELADQLLRGYAEAHPDQPWPRTVGVVVWGTPNMRSGGADIAEILYLMGVRPVWESSGLV
FT                   SGLQIIEPCELGRPRIDVSPRISGLFRDAFPNLVEMIDRAVRMVAALPEPDDDNMLRAH
FT                   VEADVVEMTARGIDVEQARRKATLRVFGCPPGGYGAGVEELIETKAWQDKADLGRAYIA
FT                   ASSHAYGEGVLGQVETERFTASLKRMDVTVKNEDTREYDMLSCTDFYNYYGGLIAAATT
FT                   VRGEAPMSLVGDSSDPTRIATRTTTEEARLILRSRILNPSWIEGLQRHGYKGAGDLSAV
FT                   LDILIGWDATADVVDDGLWERVARRYALDPAMQEWFRQVNPHALHNIVDKLLDAAQRHV
FT                   WEANPSTVEELENTYADIEGTIEEVSDDPAIAPNTRVGAPPQNPAGGLDLSELGLI"
     atgccccggc gattgcccat cccgagtaga ggccaatgcc cttgccgacc cggaacagcg        60
     ccggactccc ctcacctgcc tcatcgacag cactctcgcc cgtctggaaa gtgcatcatg       120
     accaccctga gcttcttctc ggccaccggc ggcgaactca ccctcgtcag ccaagccttg       180
     tcacggctac gcactcgtgg tctcgacatc accctcttcg gccgcaccaa ggatcagatc       240
     accgacccgg aactagcccg cgccttcgcc caggcggccg cccgcagtga cgccatcgtg       300
     cttagtttcc acggcggtac cacttcctgc ccggcatggc ccgctctggt cgaggcgtgg       360
     aaaaaccgtc gcgaatccgg tctgccgctg ccgtggatcc acatccaacc cacctccggt       420
     gacgatgacg gactcttggc cgcccaggac tgggccagcg ggctcgacga cggcacctgg       480
     aggggtctta tcgggctgct ggagatgggc ggcccggaca acgtcgaggc ggcgctacgg       540
     atcctcgtcg accgggtgcg gggtgggtca gcccccatcc ccgacgtcat ccccgccccc       600
     accgagggga tctggcatcc acgtcacggc ctgttcacca acctggccga gtaccggcac       660
     catttggacc ccgatctgcc caccgttggg atcaccttcc cgcgcagcta ctggctggag       720
     cacaacaccg cgcacatcga agccctgatc gaggccatca agggactcga cgccaacact       780
     gtgccgttct tctgtttgcg tcttcctgac gcccgccgcg gtaaccccag catggcccaa       840
     accctcgaaa ctctgctacg cgacgatgat ggcaaccgcg tcatcgacac cctgatcgac       900
     gtccacggca tgtccatgac cgccggcgta cctgccaacg cggacgccta tccgaaactt       960
     ggggtgagcg tgctgcacgc cttgacctcc tacgccccgt tggcggcatg gaaggcccag      1020
     ggtatggggg cgatggacgt tgccacccag gccgcccagc cggaattcga cggtgccctc      1080
     atcactaaat tcctggccac ccgagaagtc gatcgggtcg acgatctcac cggagccgtc      1140
     gtaccacaca tggtcccagt ccccggccgc cccgaggcga tggccgaact ggccctttcg      1200
     tgggcccggc tggcccgcac ctccgccaac caacgcaaag tggcgatcgt cttccaccac      1260
     catccgccgc gtaatgaccg gatcggctgc gccaccgggc tggacacctt tgagtcggta      1320
     caccggctcc tcgtccgaat ggccgaggat ggctacgacg tcccagaaca gttcgacagc      1380
     gccgacgacc tcgctcaggt gctgttgtca tcgttgacct gcgaccagcg ctggctcacc      1440
     ccagagcaga tgtatcagcg cgccgaggtc catgctgacc ttgccacctc ccggtcctgg      1500
     taccgggcac ttcccgcatc cgtccgcgag tcgatggatc gcgcttgggg cccgcacccg      1560
     ggatccctct tcgtccacca cgacgaattt tccttcgccg ggcacctcga cggcaacgtg      1620
     ttgttgacga tccagccgcc gcggggaaat ttcgaagctg tcactgattc cgacatccac      1680
     gacccactcc tgcccccgcc ccaccactac ctagcccact accgctggat ccgtgacgtg      1740
     ttcaaagctg acgctgtgat ccacgtcggc acccacggga gcctggaatg gctacccggc      1800
     aaagggctgg gcctgtccga ggagtgctac ccggagcttg ccttggaccg gatggtcaac      1860
     atctacccgt acatcatcaa taaccctggg gagggcaccc aggctaagcg gcgcagtgcc      1920
     gcagccctca tcgaccacct caccccaccg atgcgtcagg ccgagttata cgactccacc      1980
     gccgagatcg accgcatctt gcgcgaatac gccggggcgc agtcgcaaag cccccagcgc      2040
     gcccgacttg tcgccgagca ggtatgggac gccgtcacca aagcaggcct ggacaccgat      2100
     ctgggtctga cgagtgccga cgtcgacgcc gaccccgtcg aggtgctcga cagggtccac      2160
     catcatctgc tcgacctgca ggaccgtgaa atctctgacg gtctgcacgt gctgggccaa      2220
     gtcgtcgccg gacacgacga cccgatcgcc gccaaggtgg agtacgtcgc ccaactcacc      2280
     cgtcagccca acgggccggt accgtcccta cgcgaagccg tgctgaatgc ctgggggacc      2340
     agccttgacg aggtctctgc tagagccggc gagccagtgc ccgtcaccgc cgacctgccc      2400
     gacggtctga ccggacgcca gcttatgtcc gaggctcatc gtcgctgcgt gaagctgctc      2460
     acccctgttg tcgtccgcca ccgcgaccgg caccccgacg acaccgaagc gcacgatctg      2520
     gcggcccagt tgtgtcatga gcaactcggt gccgaacgtg gggacgtcat cgaaaccctc      2580
     acctgggtcc tcacagacct catgccccgg ctggacgcca ccaacaacga gatcgacgcc      2640
     atcatgacgg ccctcgacgg cgggttcgtg gcccctgggc cgtcgggagc gcccagccgt      2700
     ggcaacgccc acatcctgcc ctccggccga aacttctttt ccctggatcc ccagaccatg      2760
     cccaccccga cgggatggcg tgagggggtc gaactggccg accaactcct ccgagggtat      2820
     gccgaggccc accccgacca accgtggccg cgcaccgtcg gggtggtggt ctggggtacc      2880
     ccgaatatgc gcagtggagg ggccgacatc gccgagattc tgtacctcat gggggtgcgc      2940
     ccggtctggg agtcctccgg gctcgtcagc gggttgcaga tcatcgagcc ctgcgagctg      3000
     gggcgtcccc gtatcgacgt ctccccgcgc atctccggcc tgttccgtga tgccttcccc      3060
     aacctcgtcg agatgatcga ccgggcggtg cggatggtcg cagccctccc cgaacctgac      3120
     gacgacaaca tgctgcgcgc ccacgtcgag gccgacgtcg tcgaaatgac tgcccgcggg      3180
     attgacgtcg agcaagcccg ccgcaaggcg accctccggg tcttcggatg cccgcccggc      3240
     ggatacggtg ccggggtgga ggagctcatc gagaccaaag cgtggcagga caaggccgac      3300
     ctgggccggg cctacattgc cgcctcgtcc cacgcctacg gtgagggagt gctcggacag      3360
     gtggaaaccg aacggttcac cgcgagcctg aaacgcatgg acgtcaccgt caagaatgag      3420
     gacacccgcg aatacgacat gctcagctgc accgacttct acaactacta cggcgggctt      3480
     atcgctgcgg cgacgacagt acgaggcgag gcgccgatgt cgctggtagg agactcttcg      3540
     gatccgaccc gcatcgccac gcgcaccacc accgaggaag cccgactcat cttgcgctca      3600
     cgaatcctca acccatcgtg gatcgaggga ctgcaacgtc acggatataa aggagccggc      3660
     gacctatccg cagtactcga tatcctcatc ggctgggacg ccaccgccga cgtcgtcgat      3720
     gacggcctat gggaacgagt tgcgcgtcgt tacgccctcg acccggcgat gcaggaatgg      3780
     ttccggcagg tcaacccgca cgccctgcac aacatcgtcg acaaactgct cgacgccgcc      3840
     caacgtcacg tctgggaggc caatccgagc accgtcgagg aactcgagaa cacctacgct      3900
     gacatcgagg gcaccatcga agaggtctcc gacgaccccg cgatcgcccc gaacacccgg      3960
     gtgggtgcgc ctccgcagaa ccctgccggt ggacttgacc tgtccgagct ggggttgatc      4020
     taa                                                                    4023
//

If you have problems or comments...

PBIL Back to PBIL home page