(data stored in ACNUC30630 zone)

EMBL: AE017283.PE98

AE017283.PE98        Location/Qualifiers
FT   CDS_pept        complement(124075..125169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PPA0103"
FT                   /product="conserved radical SAM superfamily protein"
FT                   /note="putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PPA0103"
FT                   /db_xref="EnsemblGenomes-Tr:AAT81863"
FT                   /db_xref="GOA:Q6ABR6"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ABR6"
FT                   /protein_id="AAT81863.1"
FT                   /translation="MTVRYLVLWPTAACDLTCPYCYRRDRRGGRMPVEVADTALDLVAE
FT                   GVRTTGQPAHVQLAGGEPTLVPSLIEHVAKRVVEIRWGKVTCGIQTNAARLDGDIIAML
FT                   KRHSVRVGVSVDGPPPVHEKTRGSAAQTFRGLLALAHADIPVRVTTVLSALNVDHLDGL
FT                   AVTLAALPNVTGFGLDPLVAIGSATGRDELVPCDEAVINGITTLHRRLAQINALRATPL
FT                   RWRELETVRTALRRGPVPTTSAVDPAGRTLLPVANHPYCHAAVGESMAVAPDGSVYPCS
FT                   QAVGDMASRAGTVHSIDWESLRRRFSQDRHTLRGPCHRCALAGRCPGDCPSRVEANALA
FT                   DPEQRRTPLTCLIDSTLARLESAS"
     atgaccgtgc gctatctcgt cttgtggccg accgcggcct gcgatctcac ttgtccctac        60
     tgttaccgcc gcgaccgtcg aggcggacgg atgcccgttg aggtggcaga caccgccttg       120
     gacctcgtcg ccgagggtgt acgcaccacc gggcagcccg cccacgtcca actggccggc       180
     ggggagccga ctctggtgcc ctccctcatt gagcatgtcg ccaagcgtgt tgtggaaatt       240
     cggtggggaa aggtcacctg cggcatccag accaatgccg cccgcctcga cggcgacatc       300
     atcgccatgc tgaaacgcca cagcgtccga gtcggggtga gcgtcgacgg gccaccccca       360
     gtgcacgaga agacgcgcgg ttcggcggcg cagactttcc ggggcctgct cgccctcgct       420
     cacgccgaca tcccggtgcg ggtgacaaca gtgctgtcag ccctcaacgt cgatcaccta       480
     gacgggctgg ccgtcactct cgccgcgctt cccaacgtca ccggattcgg actcgacccg       540
     cttgtggcaa tcgggagcgc aaccgggcga gatgaactcg tgccctgcga cgaggccgtc       600
     atcaacggaa tcaccacgct ccaccggcgg ctggcacaga tcaacgcgct gcgcgccaca       660
     cccttgcgct ggcgggagtt ggagaccgtc aggactgctc tccgccgtgg tcctgtgccc       720
     acgaccagcg ccgtcgaccc cgcgggccgc actctgctcc cggtggcgaa ccacccctac       780
     tgccatgcgg cggtcgggga atcaatggcg gtcgcacccg atggcagcgt ctacccctgt       840
     tctcaagctg tcggagatat ggcttcccgg gcgggaaccg tccatagcat cgactgggaa       900
     agcttgcgac ggcgtttctc gcaagatcgc cacaccctgc gcggaccctg ccaccgctgc       960
     gccttggccg gacgatgccc cggcgattgc ccatcccgag tagaggccaa tgcccttgcc      1020
     gacccggaac agcgccggac tcccctcacc tgcctcatcg acagcactct cgcccgtctg      1080
     gaaagtgcat catga                                                       1095
//

If you have problems or comments...

PBIL Back to PBIL home page