(data stored in ACNUC32233 zone)

EMBL: AF026488.PE2

AF026488.PE2         Location/Qualifiers
FT   CDS_pept        join(<1..530,824..1057)
FT                   /codon_start=3
FT                   /gene="SPTBN2"
FT                   /product="beta III spectrin"
FT                   /note="membrane skeletal protein; beta spectrin
FT                   nonerythroid form 2"
FT                   /db_xref="GOA:O15020"
FT                   /db_xref="H-InvDB:HIT000062824.12"
FT                   /db_xref="HGNC:HGNC:11276"
FT                   /db_xref="InterPro:IPR001589"
FT                   /db_xref="InterPro:IPR001605"
FT                   /db_xref="InterPro:IPR001715"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR002017"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR016343"
FT                   /db_xref="InterPro:IPR018159"
FT                   /db_xref="InterPro:IPR036872"
FT                   /db_xref="InterPro:IPR041681"
FT                   /db_xref="PDB:1WJM"
FT                   /db_xref="PDB:1WYQ"
FT                   /db_xref="PDB:6ANU"
FT                   /db_xref="UniProtKB/Swiss-Prot:O15020"
FT                   /protein_id="AAC79503.1"
FT                   /translation="SVNGVCTDGEPSQPLLGQQRLEHSSFPEGPGPGSGDEANGPRGER
FT                   QTRTRGPAPSAMPQSRSTESAHAATLPPRGPEPSAQEQMEGMLCRKQEMEAFGKKAANR
FT                   SWQNVYCVLRRGSLGFYKDAKAASAGVPYHGEVPVSLARAQGSVAFDYRKRKHVFKLGL
FT                   QDGKEYLFQAKDEAEMSSWLRVVNAAIATASSASGEPEEPVVPSTTRGMTRAMTMPPVS
FT                   PVGAEGPVVLRSKDGREREREKRFSFFKKNK"
     ccagtgttaa tggagtctgc acagatggag agccctcaca gcccctgctg ggacaacaga        60
     gacttgagca cagcagcttc cccgaagggc cgggacctgg ctcaggggac gaagccaatg       120
     ggccccgggg agagaggcag acccggactc ggggcccggc cccatctgca atgccccaga       180
     gcaggtctac cgagtcagcc catgctgcca ccctgccgcc tcgaggccca gagccatctg       240
     cccaggagca gatggagggg atgctgtgcc gcaagcagga gatggaggcc ttcgggaaga       300
     aggctgccaa caggtcctgg cagaacgtgt actgtgtcct gcggcgtggg agcctcggct       360
     tttacaagga tgccaaggca gccagcgcgg gagtgccata ccacggagaa gtgcctgtca       420
     gcctggccag ggcccagggc agcgtcgcct ttgattaccg aaagcgcaaa catgtcttca       480
     agctgggctt acaggatgga aaagaatatt tattccaggc caaggatgag gcagagatga       540
     gctcgtggct acgggtggtg aatgcagcca ttgccacagc gtcttctgcc tctggagagc       600
     ctgaagagcc ggtggtgccc agcaccaccc ggggcatgac ccgggccatg accatgcccc       660
     cagtgtcacc cgtcggggct gaggggcctg ttgtgctccg cagcaaagac ggcagagaac       720
     gagagcgaga aaaacgcttc agcttcttta agaagaacaa gtag                        764
//

If you have problems or comments...

PBIL Back to PBIL home page