(data stored in SCRATCH3701 zone)

EMBL: AF084042.GYRA

AF084042.GYRA        Location/Qualifiers
FT   CDS_pept        2405..4933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrA"
FT                   /product="DNA gyrase subunit A"
FT                   /db_xref="GOA:Q7BSI9"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:Q7BSI9"
FT                   /protein_id="AAM48483.1"
FT                   /translation="MAETPNQRITEINLNKEMRTSFLDYAMSVIVARALPDVRDGLKPV
FT                   HRRILYAMNDLGMTSDKAYKKSARIVGEVIGKYHPHGDTAVYFTMVRMAQDFSYRNMLV
FT                   DGHGNFGSVDGDMAAAMRYTEARMSKISMELLRDINKDTIDYADNYDGSEREPVILPAR
FT                   FPNLLVNGSSGIAVGMATNIPTHHLGEVIDGVLALSHDPEITIRDLMEYIPGPDFPTAG
FT                   MIMGRSGIRRAYESGRGSITVRGRVDIEEKKNGKETIVITEIPYQVNKARLVERIAELA
FT                   REKKIDGITSLNDESDRSGMRIVIEVRRDISASVIVNNLFKMTALQTTFGINMLALVDN
FT                   HPKVLNLKEILYYYLEHQKVVIRRRTEFELRKAEARAHILEGLRIALDNIDAIIKLIRG
FT                   SKTSDVAKEGLMTQFNLSDKQAQAILDMRLQRLTGLEREKIEEEYQNLVALINDLKAIL
FT                   ADDERILEIIREELEEIKVKYADKRRTEILAGDLVSLEDEDLIPEEEVAITLTKRGYIK
FT                   RLPLSTYRSQRRGGRGIQGMSTHEDDFVEHLVATSTHDTLLFFTNTGKVYRSKGYEVPE
FT                   YGRTAKGIPIINLLGIESQEQVNAVINLSEFTDDSYLFFTTKHGVVKRTTLSQFAKIRQ
FT                   SGLRAVELRENDELISVQMTDGSKNMIIATKHGQSIYFPEENIRVMGRTAAGVRGIRLR
FT                   EDDEVIGMEVLEDDEKVLVVTEKGYGKQTPASQYPLRNRGGMGVKTVTITEKNGNLVAM
FT                   KTVTGEEDLMLMTVSGVLIRFEIDTVSQTGRSAMGVKLIRLDEDEKVATVAKVPKEEDE
FT                   VELEEEIDETLITQVPDESFEDAPGSDIEE"
     atggcagaaa caccaaatca acgaataaca gagataaact taaataaaga aatgcggaca        60
     tcattcctag actatgcgat gagtgtaatt gttgcccgtg ccctacctga tgttcgtgac       120
     gggttaaaac cagttcaccg tcgtattcta tatgcgatga atgacttagg tatgacttct       180
     gataaagcct ataaaaaatc ggctcgtatc gttggtgaag taattggtaa gtatcacccc       240
     cacggcgata cagcggttta ttttacaatg gttcgtatgg cgcaagattt tagttatcgt       300
     aatatgctag ttgatggaca tggtaacttt ggttcggttg atggcgatat ggcagcagcg       360
     atgcgttata cagaagctcg tatgtcaaaa atttcgatgg aactactgcg cgatattaat       420
     aaagacacaa ttgattacgc tgataactac gatggttctg aacgtgagcc agttatttta       480
     ccagcgcgtt tccctaactt attagtcaat ggttcgtcag gtatcgcggt tggtatggca       540
     acaaatattc ctacccacca tcttggtgaa gtaattgacg gcgttttagc acttagtcac       600
     gatccagaaa ttactattcg tgatttaatg gaatatattc caggccctga cttcccaact       660
     gctgggatga ttatgggacg tagcggaatc cgtcgcgctt acgaaagtgg ccgtggttcg       720
     attactgttc gtggtcgtgt cgatattgaa gaaaagaaaa atggtaaaga aactatcgtt       780
     attaccgaaa ttccttacca agtgaataaa gcacgcctag ttgaacgtat tgccgaacta       840
     gctcgtgaga agaaaatcga cggcatcact tccctaaatg atgagtctga ccgttcagga       900
     atgcggattg ttattgaggt tcgtcgtgat attagcgcca gtgttatcgt gaataattta       960
     ttcaaaatga cagcacttca aactactttt ggtattaata tgcttgcact tgtcgataac      1020
     catccaaaag tgcttaattt aaaagaaatt ctttattatt atttggaaca tcaaaaagta      1080
     gttattcgtc gacgtacaga atttgagctt cgtaaagcag aagcacgcgc acatatttta      1140
     gaaggtttac gaatcgctct tgataacatt gacgcgatta ttaaattaat tcgtggatca      1200
     aaaacttccg atgttgctaa agaaggcttg atgacacaat tcaacctttc tgacaaacaa      1260
     gcgcaagcca ttctggacat gcgtttgcaa cgtttaacag gtttagaacg cgaaaaaatt      1320
     gaagaagaat accaaaactt agtagcatta attaatgatt taaaagctat tttagctgat      1380
     gatgagcgta ttcttgaaat tattcgtgaa gaattagaag aaatcaaagt taaatatgcg      1440
     gataaacgtc gtacagaaat cttggctggt gatttagtaa gccttgaaga tgaagactta      1500
     atccctgaag aagaagtagc aattacgcta actaaacgtg gttatattaa acgtttacca      1560
     ctgtcgactt atcgtagtca gcgtcgaggt ggtcgtggta ttcaaggtat gtcaacacat      1620
     gaagatgact tcgtagaaca cctagttgca acgagcacgc atgatacgtt actattcttc      1680
     actaacactg gtaaagttta ccgttcgaaa ggttatgaag tacctgaata cggtcgtacc      1740
     gccaaaggta tcccaataat caacttactt ggaatcgaaa gccaagaaca agtgaacgcc      1800
     gtgataaatc tatccgaatt caccgatgat agctacctat tcttcacgac gaaacatggt      1860
     gtcgtgaagc gtacaaccct ttctcaattt gcgaaaatcc gtcaaagtgg ccttcgtgct      1920
     gtagaacttc gtgaaaacga tgaactcatt tctgttcaaa tgacagatgg tagcaaaaac      1980
     atgattatcg caacgaaaca tggtcaatct atctacttcc cagaagaaaa tatccgtgta      2040
     atgggccgta cagctgctgg tgttcgtggt attagacttc gtgaagacga tgaagttatc      2100
     ggcatggaag tactggagga cgatgaaaaa gtactcgttg taacggaaaa aggttatggt      2160
     aaacaaacgc cagcctccca atatccgctt cgtaatcgtg gtggtatggg tgttaaaacc      2220
     gttacaatca cagagaaaaa tggtaactta gtagcaatga aaactgttac tggtgaagag      2280
     gacttaatgc taatgacagt aagtggcgta ttaattcgtt tcgaaattga tacagtatca      2340
     caaactggtc gtagcgcaat gggtgttaaa ctaattcgtc ttgatgaaga tgaaaaagta      2400
     gccactgttg caaaagtacc aaaagaagaa gatgaagttg agcttgagga agaaatcgac      2460
     gaaacattaa tcacgcaagt tcctgatgaa agttttgaag atgctcctgg aagcgacata      2520
     gaagaataa                                                              2529
//

If you have problems or comments...

PBIL Back to PBIL home page