(data stored in SCRATCH3701 zone)

EMBL: AF084042.GYRB

AF084042.GYRB        Location/Qualifiers
FT   CDS_pept        370..2310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /product="DNA gyrase subunit B"
FT                   /db_xref="GOA:Q7BSI8"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q7BSI8"
FT                   /protein_id="AAM48481.1"
FT                   /translation="MSEENITNVQENASDYNEDQIQVLEGLEAVRKRPGMYIGSTSQRG
FT                   LHHLVWEIVDNAIDEALAGFCTEIEITIEADNSITVRDNGRGIPTGINEKIGRPTVEVI
FT                   FTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSTSLEVYVHREGQKYYQRFERGDVVMD
FT                   MEEQGETDYRGTIVHFTPDPQIFTETTEFDFDTLRTRTRELAFLNRGLTISIEDKREEH
FT                   KVRKDFHYEGGIRSYVEHLNKAKDVIHEPPIYLEGERDDIMVEISMQYNTGFSSNIISF
FT                   ANNIHTYEGGTHESGFKTALTRVINDYARRNKLFKDSDDNLSGEDVREGLTAIISIKHP
FT                   DPQFEGQTKTKLGNSEARSITDKLFSEALNKFMMENPDVAKKIVEKGVVASRARLAAKR
FT                   AREVARKSSGLEISSLPGKLADCSSRNPEISELYIVEGDSAGGSAKQGRDRLFQAILPI
FT                   RGKILNVEKARLDRILANEEIRTIFTAMGTGFGGDFDVSKSRYHKLIIMTDADVDGAHI
FT                   RTLLLTLFYRYMRPLLDAGYIYIAQPPLYQIKHGKQIEYVYSDGQLEDYLASLDGDTKY
FT                   SIQRYKGLGEMNPEQLWDTTMNPEHRTLLQVNIKDAIDADETFEMLMGDRVEPRRKFIE
FT                   DNAQYVKNLDV"
     atgtcagaag aaaatattac aaatgtacaa gaaaatgctt cagattataa cgaagatcaa        60
     atacaagtac tggaaggcct agaggcagta agaaaaagac ccggtatgta cattggttca       120
     actagccaac gcgggctcca tcaccttgta tgggaaattg ttgataatgc aattgatgaa       180
     gcacttgctg gtttttgtac agaaattgaa attacaattg aagctgataa cagcattact       240
     gttcgcgata acggacgtgg aattcctaca gggattaatg aaaaaatcgg tcgtccaaca       300
     gtagaagtaa tctttaccgt tctgcatgct ggtggtaaat ttggcggcgg cggatataaa       360
     gtatctggcg gacttcacgg agttggtgca tcggtagtta atgccctttc cacatctctt       420
     gaagtatacg ttcaccgtga aggtcaaaaa tattaccaac gctttgaacg tggtgatgta       480
     gtaatggata tggaagaaca aggcgaaacg gattatcgtg gaacaattgt tcactttaca       540
     ccagatccac aaattttcac agaaacaacg gaattcgatt ttgatacgct tcgtacgcgt       600
     acacgcgaac ttgctttctt gaatcgtggt ttaacgattt caattgaaga taagcgcgaa       660
     gaacacaaag ttcgtaaaga tttccactat gaaggcggaa ttcgttctta cgtggagcat       720
     ttaaataaag caaaagacgt tatccatgag ccaccaattt atttggaagg tgaacgcgat       780
     gatattatgg ttgagatttc catgcaatat aatactggat tctcaagcaa catcatttca       840
     ttcgcaaata acattcatac gtatgaaggc ggaactcacg aatctggctt taaaacggcg       900
     ttaacacgtg ttattaatga ctacgcgcgt cgtaataaat tgtttaaaga tagtgatgac       960
     aatctttctg gtgaagatgt tcgtgaaggt ttaacggcga ttatttctat caaacaccca      1020
     gatccacagt ttgaaggaca aaccaaaaca aaacttggaa attcagaagc ccgttcaatc      1080
     acggataagc tattttctga ggctttaaat aaatttatga tggaaaaccc agatgttgct      1140
     aaaaaaatcg ttgagaaggg cgttgtggct tctcgtgcac gtctggctgc taagcgcgcg      1200
     cgtgaagttg ctcgtaaaag cagtgggcta gaaatttcta gcttgccagg taaattagct      1260
     gactgttctt cccgtaatcc tgaaatcagc gaactttaca tcgttgaggg tgactcagct      1320
     ggtggttcag ctaaacaagg tcgtgaccgt ttattccaag cgattttgcc gattcgtggt      1380
     aaaattttga acgtggaaaa agcacgttta gaccgtattc tagctaacga agaaattcga      1440
     actattttta cagcgatggg tactggtttt ggtggcgatt ttgacgtttc taaatctcgt      1500
     taccacaaat taattattat gactgatgcc gatgttgatg gtgcacatat tcgtacacta      1560
     cttcttacac tattttatcg ttatatgcgt ccactgcttg atgctggtta tatctatatt      1620
     gcgcaaccac cgctttacca aattaagcat ggtaaacaaa tagaatatgt atacagcgac      1680
     ggacagttag aagactatct ggcttccctt gacggagaca ctaaatacag cattcaacga      1740
     tataaaggtc ttggagaaat gaacccagaa caactttggg atacaacaat gaatccggaa      1800
     caccgtacac tacttcaagt caatatcaaa gacgctattg atgccgatga aacttttgaa      1860
     atgttgatgg gtgaccgcgt ggaacctcgt cgtaaattca tcgaagacaa cgcgcaatac      1920
     gttaaaaact tggatgttta a                                                1941
//

If you have problems or comments...

PBIL Back to PBIL home page