(data stored in SCRATCH3701 zone)

EMBL: AF084042.MVAK1

AF084042.MVAK1       Location/Qualifiers
FT   CDS_pept        7258..8226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mvaK1"
FT                   /product="putative mevalonate kinase"
FT                   /note="putative MvaK1; ORF3"
FT                   /db_xref="GOA:Q7BSJ0"
FT                   /db_xref="InterPro:IPR006203"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR006205"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:Q7BSJ0"
FT                   /protein_id="AAM48486.1"
FT                   /translation="MATGIGTAKMILCGEHAVVYGEPAISVPFTQAVVTTNVETSIKTK
FT                   FSSAFFSGDLDDMPDFLAGIKALVVDVLNEIGNGECVSIHVVSGVPIGRGLGSSAAVAT
FT                   SIARGLYKYFNQELDSKKLLAIVNAAEKIAHGNASGVDAITVVSEKPVWYERDRKLEIM
FT                   HFPKKITFVVADTGVPSETRDAVKDVQVLYKENQVEIGKIIHQLGDISREIKTHLEGDA
FT                   DTVKIGAAMNKAQSYLETLTVSDSSLEKLIKVARSNGADGAKLTGGGRGGCIIAVAKNQ
FT                   EIAEQITKALHNAGAAQEWIFTIGEGSYESDSHRTHECGAN"
     ttggctacag gcattgggac agctaaaatg atattatgcg gagaacatgc agttgtatac        60
     ggagaaccgg caatttcagt cccatttaca caagcagtag taacgacaaa tgtagaaact       120
     tctataaaaa ccaaattttc ttcagcattt ttttcaggtg atttagatga tatgcctgat       180
     ttcttagcag gaatcaaagc attagtcgta gatgttttaa atgaaattgg aaatggtgaa       240
     tgtgtttcga ttcatgtggt ttcaggtgtt ccaatcggcc gaggattagg ttcaagtgct       300
     gctgtagcaa caagtattgc gcgtggctta tataaatact ttaatcaaga attagactcg       360
     aaaaaattat tagccattgt gaatgctgca gaaaaaattg ctcatggcaa tgctagtggt       420
     gttgatgcta tcacggttgt gagtgaaaaa ccagtatggt atgagcgaga tcgaaaacta       480
     gaaattatgc attttccaaa aaaaattacg ttcgtagtag cggatactgg agttccgagt       540
     gaaaccagag acgcggtgaa ggatgttcaa gttttatata aagaaaatca agtagaaatt       600
     ggtaaaataa ttcatcaact cggcgatatt tcccgggaaa taaagacaca tttagaaggc       660
     gatgcagata ctgtgaagat aggagctgca atgaataagg cacaatctta tttagaaact       720
     ttgacagtta gtgacagtag tttagagaaa ttaattaaag tagctagaag taatggcgcg       780
     gacggggcaa aacttactgg tggcggtaga ggtggatgca ttattgctgt agcgaaaaat       840
     caagaaatcg ctgaacaaat aacgaaggcg cttcataatg ctggagctgc acaagaatgg       900
     atttttacga ttggagaagg tagttatgaa agcgacagcc atcgcacaca cgaatgtggc       960
     gctaattaa                                                               969
//

If you have problems or comments...

PBIL Back to PBIL home page