(data stored in ACNUC7421 zone)

EMBL: AF117227.ILVH

AF117227.ILVH        Location/Qualifiers
FT   CDS_pept        complement(1403..1897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /operon="ilv"
FT                   /gene="ilvH"
FT                   /product="IlvH"
FT                   /note="acetohydroxy acid synthase III, small subunit"
FT                   /db_xref="GOA:P21622"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004789"
FT                   /db_xref="InterPro:IPR019455"
FT                   /db_xref="InterPro:IPR027271"
FT                   /db_xref="InterPro:IPR039557"
FT                   /db_xref="UniProtKB/Swiss-Prot:P21622"
FT                   /protein_id="AAF65177.1"
FT                   /translation="MMRRILSVLLENESGALSRVIGLFSQRGYNIESLTVAPTDDPTLS
FT                   RMTIQTVGDEKVLEQIEKQLHKLVDVLRVSELGQGAHVEREIMLVKIQASGYGREEVKR
FT                   NTEIFRGQIIDVTPTLYTVQLAGTSDKLDAFLASLRDVAKIVEVARSGVVGLSRGDKIM
FT                   R"
     atgatgcgcc ggattttatc ggtattactg gaaaacgaat ctggggcgtt atcgcgggtt        60
     atcggcctct tttcgcaacg cggatataat attgaaagcc tgaccgtcgc gccgacagac       120
     gatccgacgt tgtcgcgcat gactatccag acggtaggcg atgaaaaagt gcttgagcaa       180
     attgaaaagc aactgcacaa gctggttgat gtgctgcgcg tcagcgagct gggacaggga       240
     gcgcacgttg agcgggaaat catgctggtg aaaatccagg ccagcggcta cggacgggaa       300
     gaggtgaagc gtaatacgga aattttccgt ggtcagatta ttgacgttac gccaacgctg       360
     tataccgttc aactggcggg caccagcgat aaactggatg cttttctggc ctcgctgcgc       420
     gacgtggcga aaattgttga agtggcgcgt tcaggcgtcg tcgggctttc gcgcggcgat       480
     aagattatgc gctga                                                        495
//

If you have problems or comments...

PBIL Back to PBIL home page