(data stored in ACNUC26070 zone)

EMBL: AF302494.KCNE3

AF302494.KCNE3       Location/Qualifiers
FT   CDS_pept        306..617
FT                   /codon_start=1
FT                   /gene="KCNE3"
FT                   /product="voltage-gated K+ channel subunit MIRP2"
FT                   /db_xref="GOA:Q9Y6H6"
FT                   /db_xref="H-InvDB:HIT000076686.13"
FT                   /db_xref="HGNC:HGNC:6243"
FT                   /db_xref="InterPro:IPR000369"
FT                   /db_xref="InterPro:IPR005426"
FT                   /db_xref="PDB:2NDJ"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Y6H6"
FT                   /protein_id="AAG16255.1"
FT                   /translation="METTNGTETWYESLHAVLKALNATLHSNLLCRPGPGLGPDNQTEE
FT                   RRASLPGRDDNSYMYILFVMFLFAVTVGSLILGYTRSRKVDKRSDPYHVYIKNRVSMI"
     atggagacta ccaatggaac ggagacctgg tatgagagcc tgcatgccgt gctgaaggct        60
     ctaaatgcca ctcttcacag caatttgctc tgccggccag ggccagggct ggggccagac       120
     aaccagactg aagagaggcg ggccagccta cctggccgtg atgacaactc ctacatgtac       180
     attctctttg tcatgtttct atttgctgta actgtgggca gcctcatcct gggatacacc       240
     cgctcccgca aagtggacaa gcgtagtgac ccctatcatg tgtatatcaa gaaccgtgtg       300
     tctatgatct aa                                                           312
//

If you have problems or comments...

PBIL Back to PBIL home page