(data stored in ACNUC7421 zone)

HOGENOMDNA: AGRRK_2

ID   AGRRK_2; SV 1; empty ; DNA; empty ; PRO; 4005130 BP.
XX
AC   NC_011985;
XX
PR   Project: 58269;
XX
DE   Agrobacterium radiobacter K84 chromosome 1, complete genome.
XX
OS   Agrobacterium radiobacter K84
OC   Bacteria; Proteobacteria; Alphaproteobacteria; Rhizobiales; Rhizobiaceae;
OC   Rhizobium/Agrobacterium group; Agrobacterium.
XX
RN   [1]
RP   1-4005130
RX   PUBMED; 19251847.
RA   Slater,S.C., Goldman,B.S., Goodner,B., Setubal,J.C., Farrand,S.K.,
RA   Nester,E.W., Burr,T.J., Banta,L., Dickerman,A.W., Paulsen,I., Otten,L.,
RA   Suen,G., Welch,R., Almeida,N.F., Arnold,F., Burton,O.T., Du,Z., Ewing,A.,
RA   Godsy,E., Heisel,S., Houmiel,K.L., Jhaveri,J., Lu,J., Miller,N.M.,
RA   Norton,S., Chen,Q., Phoolcharoen,W., Ohlin,V., Ondrusek,D., Pride,N.,
RA   Stricklin,S.L., Sun,J., Wheeler,C., Wilson,L., Zhu,H. and Wood,D.W.;
RT   "Genome sequences of three agrobacterium biovars help elucidate the
RT   evolution of multichromosome genomes in bacteria";
RL   J. Bacteriol. 191 (8), 2501-2511 (2009)
XX
RN   [2]
RP   1-4005130
RG   NCBI Genome Project
RT   "Direct Submission";
RL   Submitted (28-JAN-2009) National Center for Biotechnology Information,
RL   NIH, Bethesda, MD 20894, USA
XX
RN   [3]
RP   1-4005130
RG   Agrobacterium Consortium
RA   Setubal,J., Wood,D., Slater,S., Nester,E., Farrand,S., Goldman,B.,
RA   Burr,T., Goodner,B., Otten,L., Dickerman,A., Almeida,N., Sun,J.,
RA   Jhaveri,J., Banta,L. and Houmiel,K.;
RT   "Direct Submission";
RL   Submitted (14-MAR-2007) Virginia Bioinformatics Institute, Virginia Tech,
RL   Washington Street, Box 0477, Blacksburg, VA 24061, USA
XX
CC   PROVISIONAL REFSEQ: This record has not yet been subject to final
CC   NCBI review. The reference sequence was derived from CP000628.
CC   COMPLETENESS: full length.
XX
FH   Key             Location/Qualifiers
FT   source          1..4005130
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:311403"
FT                   /isolate="ATCC BAA-868"
FT                   /strain="K84"
FT                   /organism="Agrobacterium radiobacter K84"
FT                   /chromosome="1"
FT                   /culture_collection="ATCC:BAA-868"
FT   gene            190..1023
FT                   /db_xref="GeneID:7371014"
FT                   /locus_tag="Arad_0001"
FT   CDS_pept        190..1023
FT                   /locus_tag="Arad_0001"
FT                   /gene_family="HOG000218052" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:222084202"
FT                   /db_xref="GeneID:7371014"
FT                   /translation="MESSVENRTSFFHLHLISDSTGETLISAGRAASVQFHASQPIEHV
FT                   YPLIRNRKQLLPVLEAIDHSPGIVLYTIVDRELADFIDERCREMGVPCVNVLEPVMNVF
FT                   QTYLGTASRRRVGAQHVMNADYFARIEALNFTMDHDDGQMQDDYNDADVVIIGISRTSK
FT                   TPTSIYLANRGIKTANIPIIAGVPLPESLIQATRPLIVGLVATTDRISQVRENRILGAT
FT                   TGFDRGGYTDRATISEELKYARSLCARHNWPIIDVTRRSIEETAAAIVALRPKLR"
FT                   /protein_id="YP_002542727.1"
FT   misc_feature    214..1020
FT                   /note="Domain of unknown function (DUF299); Region: DUF299;
FT                   cl00780"
FT                   /db_xref="CDD:174387"
FT                   /locus_tag="Arad_0001"
FT   gene            1062..1661
FT                   /db_xref="GeneID:7368717"
FT                   /locus_tag="Arad_4980"