(data stored in ACNUC7421 zone)

HOGENOMDNA: AGRRK_2.PE1

AGRRK_2.PE1          Location/Qualifiers
FT   CDS_pept        190..1023
FT                   /locus_tag="Arad_0001"
FT                   /gene_family="HOG000218052" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:222084202"
FT                   /db_xref="GeneID:7371014"
FT                   /translation="MESSVENRTSFFHLHLISDSTGETLISAGRAASVQFHASQPIEHV
FT                   YPLIRNRKQLLPVLEAIDHSPGIVLYTIVDRELADFIDERCREMGVPCVNVLEPVMNVF
FT                   QTYLGTASRRRVGAQHVMNADYFARIEALNFTMDHDDGQMQDDYNDADVVIIGISRTSK
FT                   TPTSIYLANRGIKTANIPIIAGVPLPESLIQATRPLIVGLVATTDRISQVRENRILGAT
FT                   TGFDRGGYTDRATISEELKYARSLCARHNWPIIDVTRRSIEETAAAIVALRPKLR"
FT                   /protein_id="YP_002542727.1"
     ATGGAAAGTA GCGTGGAAAA CCGGACAAGC TTCTTTCATC TTCATCTGAT TTCTGACTCA        60
     ACCGGCGAGA CTCTGATCTC CGCCGGACGT GCTGCATCCG TGCAATTCCA TGCCAGCCAG       120
     CCGATTGAGC ATGTCTACCC ACTGATTCGG AATCGCAAGC AGCTGCTGCC GGTTCTCGAA       180
     GCGATCGACC ACAGCCCCGG CATTGTCCTC TATACGATCG TCGATCGCGA GCTTGCCGAT       240
     TTCATCGACG AGCGTTGCCG GGAGATGGGC GTACCCTGTG TCAATGTGCT TGAACCGGTG       300
     ATGAACGTCT TCCAGACTTA TCTCGGCACC GCTTCGCGCC GACGTGTCGG CGCCCAGCAT       360
     GTGATGAATG CCGACTACTT CGCCCGCATC GAAGCCTTGA ACTTCACCAT GGATCACGAT       420
     GACGGGCAGA TGCAGGATGA TTATAATGAC GCCGATGTCG TCATCATCGG TATCAGTCGA       480
     ACATCGAAGA CGCCGACCAG CATCTACCTG GCGAACCGGG GCATCAAGAC CGCCAATATC       540
     CCGATCATCG CTGGCGTTCC CTTGCCAGAA AGCCTGATCC AGGCAACCAG GCCGCTGATC       600
     GTCGGGCTGG TGGCAACCAC GGACCGAATA TCGCAGGTGC GCGAAAACCG CATTCTCGGA       660
     GCGACCACCG GCTTCGATCG TGGTGGCTAC ACCGACCGCG CCACCATCTC CGAAGAGTTG       720
     AAATATGCCC GGTCGCTCTG TGCCCGGCAT AATTGGCCGA TCATCGATGT CACCCGCCGC       780
     TCGATCGAGG AGACGGCAGC CGCCATTGTT GCCCTGCGCC CGAAGCTGCG CTAA             834
//

If you have problems or comments...

PBIL Back to PBIL home page