(data stored in ACNUC8465 zone)

HOGENOMDNA: AGRT5_1

ID   AGRT5_1; SV 2; empty ; DNA; empty ; PRO; 2841580 BP.
XX
AC   NC_003062;
XX
PR   Project: 57865;
XX
DE   Agrobacterium tumefaciens str. C58 chromosome circular, complete sequence.
XX
OS   Agrobacterium tumefaciens str. C58
OC   Bacteria; Proteobacteria; Alphaproteobacteria; Rhizobiales; Rhizobiaceae;
OC   Rhizobium/Agrobacterium group; Agrobacterium.
XX
RN   [1]
RP   1-2841580
RX   PUBMED; 11743194.
RA   Goodner,B., Hinkle,G., Gattung,S., Miller,N., Blanchard,M., Qurollo,B.,
RA   Goldman,B.S., Cao,Y., Askenazi,M., Halling,C., Mullin,L., Houmiel,K.,
RA   Gordon,J., Vaudin,M., Iartchouk,O., Epp,A., Liu,F., Wollam,C.,
RA   Allinger,M., Doughty,D., Scott,C., Lappas,C., Markelz,B., Flanagan,C.,
RA   Crowell,C., Gurson,J., Lomo,C., Sear,C., Strub,G., Cielo,C. and Slater,S.;
RT   "Genome sequence of the plant pathogen and biotechnology agent
RT   Agrobacterium tumefaciens C58";
RL   Science 294 (5550), 2323-2328 (2001)
XX
RN   [2]
RP   1-2841580
RX   PUBMED; 11743193.
RA   Wood,D.W., Setubal,J.C., Kaul,R., Monks,D.E., Kitajima,J.P., Okura,V.K.,
RA   Zhou,Y., Chen,L., Wood,G.E., Almeida,N.F. Jr., Woo,L., Chen,Y.,
RA   Paulsen,I.T., Eisen,J.A., Karp,P.D., Bovee,D. Sr., Chapman,P.,
RA   Clendenning,J., Deatherage,G., Gillet,W., Grant,C., Kutyavin,T., Levy,R.,
RA   Li,M.J., McClelland,E., Palmieri,A., Raymond,C., Rouse,G.,
RA   Saenphimmachak,C., Wu,Z., Romero,P., Gordon,D., Zhang,S., Yoo,H., Tao,Y.,
RA   Biddle,P., Jung,M., Krespan,W., Perry,M., Gordon-Kamm,B., Liao,L., Kim,S.,
RA   Hendrick,C., Zhao,Z.Y., Dolan,M., Chumley,F., Tingey,S.V., Tomb,J.F.,
RA   Gordon,M.P., Olson,M.V. and Nester,E.W.;
RT   "The genome of the natural genetic engineer Agrobacterium tumefaciens
RT   C58";
RL   Science 294 (5550), 2317-2323 (2001)
XX
RN   [3]
RP   1-2841580
RA   Hinkle,G., Slater,S.C. and Goodner,B.;
RT   "Complete Genome Sequence of Agrobacterium tumefaciens C58 (Rhizobium
RT   radiobacter C58), the Causative Agent of Crown Gall Disease in Plants";
RL   Unpublished
XX
RN   [4]
RP   1-2841580
RG   agrobacterium.org
RA   Slater,S.C., Setubal,J.C., Zhao,Y., Goodner,B., Houmiel,K., Sun,J.,
RA   Kaul,R., Goldman,B., Chen,Q., Huang,W.Mun., Casjens,S., Farrand,S.,
RA   Burr,T., Nester,E., Kadoi,R., Ostheimer,T., Pride,N., Sabo,A., Henry,E.,
RA   Telepak,E. and Wood,D.;
RT   "Direct Submission";
RL   Submitted (30-OCT-2007) Virginia Bioinformatics institute, Virginia
RL   Polytechnic Institute and State University, Washington Street Box 0477,
RL   Blacksburg, VA 24060, USA
XX
RN   [5]
RP   1-2841580
RG   NCBI Genome Project
RT   "Direct Submission";
RL   Submitted (15-OCT-2001) National Center for Biotechnology Information,
RL   NIH, Bethesda, MD 20894, USA
XX
RN   [6]
RP   1-2841580
RA   Hinkle,G., Slater,S.C. and Goodner,B.;
RT   "Direct Submission";
RL   Submitted (14-AUG-2001) Cereon Genomics, 45 Sidney Street, Cambridge, MA
RL   02139, USA
XX
CC   PROVISIONAL REFSEQ: This record has not yet been subject to final
CC   NCBI review. The reference sequence was derived from AE007869.
CC   On or before Nov 7, 2007 this sequence version replaced
CC   gi:17933925, gi:15887359.
CC   COMPLETENESS: full length.
XX
FH   Key             Location/Qualifiers
FT   source          1..2841580
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:176299"
FT                   /strain="C58"
FT                   /organism="Agrobacterium tumefaciens str. C58"
FT                   /chromosome="circular"
FT                   /culture_collection="ATCC:33970"
FT   gene            203..1024
FT                   /old_locus_tag="AGR_C_5142"
FT                   /db_xref="GeneID:1132039"
FT                   /locus_tag="Atu0001"
FT   CDS_pept        203..1024
FT                   /locus_tag="Atu0001"
FT                   /gene_family="HOG000218052" [ FAMILY / ALN / TREE ]
FT                   /old_locus_tag="AGR_C_5142"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:15887360"
FT                   /db_xref="GeneID:1132039"
FT                   /translation="MENKKSFFHLHLISDSTGETLMSAGRAVSAQFHTSMPVEHVYPMI
FT                   RNQKQLAQVIDLIDKEPGIVLYTIVDQQLAEFLDLRCHAIGVPCVNVLEPIIGIFQTYL
FT                   GAPSRRRVGAQHALNADYFARIEALNFAMDHDDGQMPETYDDADVVIIGISRTSKTPTS
FT                   IYLANRGIKTANIPVVPNVPLPESLYAATRPLIVGLVATSDRISQVRENRDLGTTGGFD
FT                   GGRYTDRATIMEELKYARALCARNNWPLIDVTRRSIEETAAAILALRPRTR"
FT                   /protein_id="NP_353041.1"
FT   misc_feature    212..1021
FT                   /old_locus_tag="AGR_C_5142"
FT                   /note="Domain of unknown function (DUF299); Region: DUF299;
FT                   cl00780"
FT                   /locus_tag="Atu0001"
FT                   /db_xref="CDD:174387"
FT   gene            1056..1655
FT                   /old_locus_tag="AGR_C_2"
FT                   /db_xref="GeneID:1132040"
FT                   /locus_tag="Atu0002"