(data stored in ACNUC7421 zone)

HOGENOMDNA: AGRVS_6

ID   AGRVS_6; SV 1; empty ; DNA; empty ; PRO; 3726375 BP.
XX
AC   NC_011989;
XX
PR   Project:58249;
XX
DE   Agrobacterium vitis S4 chromosome 1, complete genome.
XX
OS   Agrobacterium vitis S4
OC   Bacteria; Proteobacteria; Alphaproteobacteria; Rhizobiales; Rhizobiaceae;
OC   Rhizobium/Agrobacterium group; Agrobacterium.
XX
RN   [1]
RP   1-3726375
RX   PUBMED; 19251847.
RA   Slater,S.C., Goldman,B.S., Goodner,B., Setubal,J.C., Farrand,S.K.,
RA   Nester,E.W., Burr,T.J., Banta,L., Dickerman,A.W., Paulsen,I., Otten,L.,
RA   Suen,G., Welch,R., Almeida,N.F., Arnold,F., Burton,O.T., Du,Z., Ewing,A.,
RA   Godsy,E., Heisel,S., Houmiel,K.L., Jhaveri,J., Lu,J., Miller,N.M.,
RA   Norton,S., Chen,Q., Phoolcharoen,W., Ohlin,V., Ondrusek,D., Pride,N.,
RA   Stricklin,S.L., Sun,J., Wheeler,C., Wilson,L., Zhu,H. and Wood,D.W.;
RT   "Genome sequences of three agrobacterium biovars help elucidate the
RT   evolution of multichromosome genomes in bacteria";
RL   J. Bacteriol. 191 (8), 2501-2511 (2009)
XX
RN   [2]
RP   1-3726375
RG   NCBI Genome Project
RT   "Direct Submission";
RL   Submitted (28-JAN-2009) National Center for Biotechnology Information,
RL   NIH, Bethesda, MD 20894, USA
XX
RN   [3]
RP   1-3726375
RG   Agrobacterium Consortium
RA   Setubal,J., Wood,D., Slater,S., Nester,E., Farrand,S., Goldman,B.,
RA   Burr,T., Goodner,B., Otten,L., Dickerman,A., Almeida,N., Sun,J.,
RA   Jhaveri,J., Banta,L. and Houmiel,K.;
RT   "Direct Submission";
RL   Submitted (14-MAR-2007) Virginia Bioinformatics Institute, Virginia Tech,
RL   Washington Street, Box 0477, Blacksburg, VA 24061, USA
XX
CC   PROVISIONAL REFSEQ: This record has not yet been subject to final
CC   NCBI review. The reference sequence was derived from CP000633.
CC   Strain/DNA available from Tom Burr, Cornell University,
CC   tjb1@cornell.edu.  A. vitis S4 was isolated by Dr. Erno Szegedi in
CC   1981 from aerial gall that developed on a two-year-old woody
CC   grapevine cane.
CC   COMPLETENESS: full length.
XX
FH   Key             Location/Qualifiers
FT   source          1..3726375
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:311402"
FT                   /country="Hungary: Orgovany"
FT                   /isolate="Kecskemet-Hungary"
FT                   /strain="S4; ATCC BAA-846"
FT                   /host="Vitis vinifera cv. 'Izsaki Sarfeher'"
FT                   /organism="Agrobacterium vitis S4"
FT                   /chromosome="1"
FT                   /culture_collection="ATCC:BAA-846"
FT   gene            203..1024
FT                   /db_xref="GeneID:7387188"
FT                   /locus_tag="Avi_0001"
FT   CDS_pept        203..1024
FT                   /locus_tag="Avi_0001"
FT                   /gene_family="HOG000218052" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:222147016"
FT                   /db_xref="GeneID:7387188"
FT                   /translation="MENRKNFFHLHLISDSTGETLISAGRAAAVQFPHSNPIEHVYPLV
FT                   RNRRQADAVLQSIDKEPGIVLYTIVDPELADFIDRRCIEIGVPSVNVLEPVIGTFQAYL
FT                   GPLARRRVGAQHVMNADYFARIEALNYTMDHDDGQMAEDYDQADVVLVGISRTSKTPTS
FT                   IYLANRGIKTANIPIVPDSPLPESLFAAKGPLIVGLIATSDRISQVRGHRELGTVSGFD
FT                   PSDYTDRASIAEELKYARSLCARHNWPVIDVTRRSIEETAAAIIALRAKPR"
FT                   /protein_id="YP_002547973.1"
FT   gene            1056..1655
FT                   /db_xref="GeneID:7389006"
FT                   /locus_tag="Avi_0002"